Property Summary

NCBI Gene PubMed Count 82
PubMed Score 156.54
PubTator Score 113.53

Knowledge Summary

Patent (6,027)

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6685 6.2e-04
Disease Target Count Z-score Confidence
Asthma 349 4.93 2.5
Disease Target Count
Asthma-related traits 2 1

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1461 confirmatory 2314 / 12627 / 206429 qHTS Assay for Antagonists of the Neuropeptide S Receptor: cAMP Signal Transduction
1464 summary 11 / 0 / 0 Quantitative High-Throughput Screen for Antagonists of the Neuropeptide S Receptor: Summary
1489 confirmatory 31 / 92 / 90 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Calcium Signal Transduction
1491 confirmatory 71 / 72 / 116 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: cAMP Signal Transduction
1493 confirmatory 12 / 4 / 0 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Radioligand Displacement
2566 confirmatory 16 / 4 / 0 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Radioligand Displacement, SAR for Probe
2567 confirmatory 59 / 60 / 67 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Calcium Signal Transduction, SAR for Probe
2568 confirmatory 70 / 38 / 78 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: cAMP Signal Transduction, SAR for Probe
434931 confirmatory 73 / 15 / 9 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Robust Characterization of Calcium Signal Transduction
434936 confirmatory 73 / 14 / 10 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Robust Characterization of cAMP Signal Transduction
More...

Gene RIF (86)

PMID Text
26865629 findings demonstrate that hNPS-(1-10) is a biased agonist favoring Galphaq-dependent signaling. It may represent a valuable chemical probe for further investigation of the therapeutic potential of human NPS receptor-directed signalingin vivo.
26235955 Results suggest the functional NPSR1 gene A/T variant to influence glutamate+glutamine concentrations in the bilateral anterior cingulate cortex in healthy male subjects during CCK-4 induced panic
25971599 anxiety sensitivity correlated negatively with prefrontal activity in NPSR1 rs324981 carriers possibly suggesting a decompensation of the adaptive compensatory upregulation
25842293 The results suggest neuropeptide S receptor gene variation to be associated with alterations of prefrontal functioning in the attentional functions alerting and executive control partly modulated by anxiety sensitivity.
25744621 The T-allele of the NPSR1 rs324981 polymorphism is associated with increased impulsivity and ADHD-related traits in non-clinical cohorts.
25091462 Genetic variation at the NPSR1 locus impacts children's predisposition to ecurrent abdominal pain episodes in a Swedish population.
24915894 Neuropeptide S receptor 1 (NPSR1) activates cancer-related pathways and is widely expressed in neuroendocrine tumors.
24896296 The functional SNP rs324981 located in the gene of NPSR1 was significantly associated with objectively obtained sleep parameters in a sample of elderly white subjects
24800784 study provides first evidence for the assumption that a NPSR1 variant modulates brain activation under stress, interacting with the environmental risk factor urban upbringing
24754478 Results show that NPSR1 polymorphism is associated with AUD and alcohol consumption, dependent on sex, environment and age.
24439655 gene polymorphism is a risk factor for high IgE-associated atopic eczema at the age of two years in Finland if there is no probiotic treatment
24331455 In the Estonian population, NPSR1 A/T polymorphism together with environmental factors is associated with anxious, depressive and activity-related traits, increased prevalence of affective/anxiety disorders and a higher likelihood of suicidal behaviour.
24239856 NPS receptor may have a pathological role in individuals with severe asthma and/or elevated serum IgE levels.
23911665 The present data demonstrated that QA1 and PI1 act as potent NPSR antagonists in vitro, however their usefulness for in vivo investigations in mice seems limited probably by pharmacokinetic reasons.
23680103 Relate NPSR1 genotype to early onset obsessive-compulsive disorder.
23565190 RORA SNPs are associated with childhood asthma and show epistasis with NPSR1, and the interaction between RORA and NPSR1 may be of biological relevance.
23466585 The results of this study showed involvement of the NPS system in the regulation of the neuroendocrine stress response in humans.
23372674 DNA methylation levels in the promoter of NPSR1 showed small but significant associations with asthma and to related traits such as allergy and certain environmental exposures.
23325374 NPSR1 A/T polymorphism is associated with impulsivity, ADHD symptoms and personality, mirroring the activity- and anxiety-mediating role of NPSR1.
23319044 In summary, the more active NPSR1 T allele may confer enhanced response inhibition and increased error monitoring and might drive particularly error monitoring as a neurophysiological endophenotype of anxiety
23142110 NPS is able to stimulate human monocyte chemotaxis and that this effect is entirely due to selective NPSR activation.
23103692 results suggest a potential protective function of the NPSR1 rs324981 A/A genotype against pathologically enhanced anxiety that might be explained by stronger reflective prefrontal regulation over the subcortical fear response.
22548958 NPSR1 gene is associated with reduced risk of rheumatoid arthritis.
22479518 analysis of molecular evolution of the neuropeptide S receptor and cross-species comparison
22404660 Differential gene-environment effects of the NPSR rs324981 T allele indicate recent life events with respect to anxiety sensitivity.
22216302 findings represent a first step to decipher NPSR1 locus complexity and its impact on several human conditions NPS antagonists have been recently described, and our results are of potential pharmacogenetic relevance
22078257 we consider NPSR as a promising target for antipsychotic drug development
21707994 There is an NPSR1 isoform-specific link to pathogenetic processes in asthma and allergy.
21525857 Ther neuropeptide S receptor genotype is associated with increased amygdala responsiveness to fear-relevant stimuli.
20705147 NPS-NPSR1 signaling is likely involved in anxiety
20705147 Observational study of gene-disease association. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628342 data suggest a genetic and neuroanatomical substrate for catastrophizing overinterpretations of fear reactions.
20628342 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603625 results provide converging evidence for a female-dominant role of NPSR gene variation in panic disorder through heightened autonomic arousal and distorted processing of anxiety-relevant emotional stimuli.
20603625 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20179762 Data show that NPSR1 polymorphism may be relevant to RA susceptibility and its clinical manifestation.
20179762 Observational study of gene-disease association. (HuGE Navigator)
19996348 Observational study of gene-disease association. (HuGE Navigator)
19951440 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874863 Results suggest that N-linked glycosylation is not important for neuropeptide S receptor biogenesis or function, and that residue D105 might be critical for receptor binding.
19824051 The available information regarding NPS and its receptor and the biological actions modulated by the NPS-NPSR system, is summarized.
19732772 Expression of several neuropeptides is induced upon NPS-NPSR1 signaling; NPSR1 variants are associated with colonic transit in functional gastrointestinal diseases
19732772 Observational study of gene-disease association. (HuGE Navigator)
19624525 Association of G-protein-coupled receptor 154 with asthma and total IgE in a population of the Caribbean coast of Colombia.
19624525 Observational study of gene-disease association. (HuGE Navigator)
19614867 Data suggest that the NPS/NPSR1 pathway may participate in the regulation of the peptide hormone production in enteroendocrine cells of the small intestine.
19325992 strongly suggest that NPSR1 is not involved in the pathogenesis of eczema.
19325992 Observational study of gene-disease association. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
18588753 Relatively high level of expression of mRNA for SLC9A3RI was detected wheres lower level of S100A7 and GPRA were found.
18340359 Observational study of gene-disease association. (HuGE Navigator)
18305139 In asthma and atopic sensitization significant gene-gene interactions were found between TNC and NPSR1 SNPs.
18305139 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18285428 A strong interaction was seen between current regular contact to farm animals and several NPSR1 polymorphisms. Suggests the effect of farm animal contact on the development of allergic symptoms in children is modified by NPSR1 genetic background.
18285428 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17854592 Observational study of gene-disease association. (HuGE Navigator)
17854592 NPSR1 polymorphism is associated with IBD susceptibility. Specific NPSR1 alleles might act as genetic risk factors for chronic inflammatory diseases of the epithelial barrier organs.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17702965 Observational study of gene-disease association. (HuGE Navigator)
17702965 Results provide some further support for the role of genetic variation in GPR154 (NPSR1) in asthma susceptibility.
17669576 evidence for a gender-specific effect of Neuropeptide S receptor in the pathogenesis of panic disorder
17285544 The polymorphisms of SNP563704 and SNP522363 are not associated with allergic asthma in Han nationality in Hubei Chinese population. However, the haplotypes are associated with allergic asthma.
17285544 Observational study of gene-disease association. (HuGE Navigator)
17210045 Observational study of gene-disease association. (HuGE Navigator)
17210045 a common susceptibility factor for atopic manifestations in asthma is likely conferred by the locus containing the GPR154 gene
16938805 In infants with respiratory distress syndrome (RDS) born at 32-35 weeks of gestation, GPRA haplotype H1 was significantly underrepresented in RDS, whereas haplotype H4/H5 was associated with an increased risk.
16926187 Because remodeling of airway epithelium is a feature of chronic asthma, the up-regulation of MMP10 and TIMP3 by NPS-NPSR1 signaling may be of relevance in the pathogenesis of asthma.
16829631 GPRA may contribute to the asthmatic phenotype by altering the activity of other pathways, such as neurally mediated mechanisms, that contribute to disease
16790440 the key residues of NPS involved in NPSR activation and suggest a molecular basis for the functional effects of the N107I mutation and for its putative pathophysiological link with asthma
16522461 Observational study of gene-disease association. (HuGE Navigator)
16522461 There is a role of the GPR154 gene in the genetic susceptibility of asthma.
16098057 No difference in allele frequency or haplotype for asthma
15990798 the GPRA gene does not contribute to the shared genetic predisposition of atopic dermatitis and allergic airways disease
15947423 GPRA might have functional relevance in modulating asthma by increased expression levels in the relevant tissues under diseased state and by potential inhibitory effect of GPRA-A activation on cell growth
15941840 GPRA gene is associated with asthma and bronchial hyperreactivity.
15764725 GPRA gene polymorphism is associated with asthma in a large german population.
15710598 Our results indicate that polymorphisms and haplotypes in the haplotype block of GPR154 are associated with asthma, rhinoconjunctivitis, and sensitization in European children.
15073379 properties of GPRA make it a strong candidate for involvement in the pathogenesis of asthma and other IgE-mediated diseases; GPRA encodes isoforms produced in distinct patterns by bronchial epithelial & smooth muscle cells in asthma & healthy individuals
14757815 Vasopressin receptor-related receptor 1, also called G protein-coupled receptor 154, has dual signaling properties in coupling to both G(q) and G(S) pathways.

AA Sequence

MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLFVFTIVGNSVV      1 - 70
LFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLV     71 - 140
SLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPY    141 - 210
MTIVAFLVYFIPLTIISIMYGIVIRTIWIKSKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIII    211 - 280
LAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSR    281 - 350
MTFRERTERHEMQILSKPEFI                                                     351 - 371
//

Text Mined References (83)

PMID Year Title
26865629 2016 Human Neuropeptide S Receptor Is Activated via a G?q Protein-biased Signaling Cascade by a Human Neuropeptide S Analog Lacking the C-terminal 10 Residues.
26235955 2015 Neuropeptide S receptor gene variation modulates anterior cingulate cortex Glx levels during CCK-4 induced panic.
25971599 2015 Neuropeptide S receptor gene variation and neural correlates of cognitive emotion regulation.
25842293 2015 Modulation of prefrontal functioning in attention systems by NPSR1 gene variation.
25744621 2015 Further evidence for the association of the NPSR1 gene A/T polymorphism (Asn107Ile) with impulsivity and hyperactivity.
25091462 2014 NPSR1 polymorphisms influence recurrent abdominal pain in children: a population-based study.
24915894 2014 Neuropeptide S receptor 1 (NPSR1) activates cancer-related pathways and is widely expressed in neuroendocrine tumors.
24896296 2014 Genetic association of objective sleep phenotypes with a functional polymorphism in the neuropeptide S receptor gene.
24800784 2014 A functional variant in the neuropeptide S receptor 1 gene moderates the influence of urban upbringing on stress processing in the amygdala.
24754478 2015 Neuropeptide S receptor gene variant and environment: contribution to alcohol use disorders and alcohol consumption.
24439655 Interaction of NPSR1 genotypes and probiotics in the manifestation of atopic eczema in early childhood.
24331455 2014 Interaction of the neuropeptide S receptor gene Asn¹??Ile variant and environment: contribution to affective and anxiety disorders, and suicidal behaviour.
24239856 2014 Enhanced expression of neuropeptide S (NPS) receptor in eosinophils from severe asthmatics and subjects with total IgE above 100IU/ml.
23911665 2013 In vitro and in vivo pharmacological characterization of the novel neuropeptide S receptor ligands QA1 and PI1.
23680103 2013 The functional coding variant Asn107Ile of the neuropeptide S receptor gene (NPSR1) influences age at onset of obsessive-compulsive disorder.
23565190 2013 Interaction between retinoid acid receptor-related orphan receptor alpha (RORA) and neuropeptide S receptor 1 (NPSR1) in asthma.
23466585 2013 Neuropeptide S receptor gene is associated with cortisol responses to social stress in humans.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23372674 2013 DNA methylation in the Neuropeptide S Receptor 1 (NPSR1) promoter in relation to asthma and environmental factors.
23325374 2014 A functional NPSR1 gene variant and environment shape personality and impulsive action: a longitudinal study.
23319044 2013 Neuropeptide S receptor (NPSR1) gene variation modulates response inhibition and error monitoring.
23142110 2013 Neuropeptide S stimulates human monocyte chemotaxis via NPS receptor activation.
23103692 2013 Neuropeptide S receptor gene: fear-specific modulations of prefrontal activation.
22548958 2012 NPSR1 gene is associated with reduced risk of rheumatoid arthritis.
22479518 2012 Molecular evolution of the neuropeptide S receptor.
22404660 2014 Neuropeptide S receptor gene (NPSR) and life events: G × E effects on anxiety sensitivity and its subdimensions.
22216302 2011 Multiple polymorphisms affect expression and function of the neuropeptide S receptor (NPSR1).
22078257 2012 The functional coding variant Asn107Ile of the neuropeptide S receptor gene (NPSR1) is associated with schizophrenia and modulates verbal memory and the acoustic startle response.
21707994 2011 The asthma candidate gene NPSR1 mediates isoform specific downstream signalling.
21525857 2011 Neuropeptide-S (NPS) receptor genotype modulates basolateral amygdala responsiveness to aversive stimuli.
20705147 2010 Assessment of the neuropeptide S system in anxiety disorders.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20628342 2010 A neuropeptide S receptor variant associated with overinterpretation of fear reactions: a potential neurogenetic basis for catastrophizing.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603625 2011 Neuropeptide S receptor gene?--?converging evidence for a role in panic disorder.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20179762 2010 Analysis of neuropeptide S receptor gene (NPSR1) polymorphism in rheumatoid arthritis.
19996348 2010 Positionally cloned genes and age-specific effects in asthma and atopy: an international population-based cohort study (ECRHS).
19951440 2009 Analyses of associations between three positionally cloned asthma candidate genes and asthma or asthma-related phenotypes in a Chinese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874863 2010 Importance of extracellular loop one of the neuropeptide S receptor for biogenesis and function.
19824051 2010 Neurobiology, pharmacology, and medicinal chemistry of neuropeptide S and its receptor.
19732772 2010 Neuropeptide S receptor induces neuropeptide expression and associates with intermediate phenotypes of functional gastrointestinal disorders.
19624525 2009 Association of G-protein-coupled receptor 154 with asthma and total IgE in a population of the Caribbean coast of Colombia.
19614867 2010 Neuropeptide S receptor 1 expression in the intestine and skin--putative role in peptide hormone secretion.
19325992 2009 Lack of association between neuropeptide S receptor 1 gene (NPSR1) and eczema in five European populations.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
18588753 Epithelial genes in chronic rhinosinusitis with and without nasal polyps.
18340359 2008 Lack of association between genetic variation in G-protein-coupled receptor for asthma susceptibility and childhood asthma and atopy.
18305139 2008 Biological and genetic interaction between tenascin C and neuropeptide S receptor 1 in allergic diseases.
18285428 2009 The protective effect of farm animal exposure on childhood allergy is modified by NPSR1 polymorphisms.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17854592 2007 Neuropeptide s receptor 1 gene polymorphism is associated with susceptibility to inflammatory bowel disease.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17702965 2007 Comprehensive testing of positionally cloned asthma genes in two populations.
17669576 2007 Gender-specific association of a functional coding polymorphism in the Neuropeptide S receptor gene with panic disorder but not with schizophrenia or attention-deficit/hyperactivity disorder.
17285544 2007 [Study on the association of single nucleotide polymorphisms and haplotypes of GPR154 gene with allergic asthma in Han nationality in Hubei Chinese population].
17210045 2007 Chromosome 7p linkage and GPR154 gene association in Italian families with allergic asthma.
16938805 2006 G protein-coupled receptor for asthma susceptibility associates with respiratory distress syndrome.
16926187 2006 Downstream target genes of the neuropeptide S-NPSR1 pathway.
16829631 2006 Expression and function of NPSR1/GPRA in the lung before and after induction of asthma-like disease.
16790440 2006 Structure-function relationships in the neuropeptide S receptor: molecular consequences of the asthma-associated mutation N107I.
16522461 2006 G protein-coupled receptor 154 gene polymorphism is associated with airway hyperresponsiveness to methacholine in a Chinese population.
16098057 2005 Absence of association between asthma and high serum immunoglobulin E associated GPRA haplotypes and adult atopic dermatitis.
15990798 2005 Lack of association of the G protein-coupled receptor for asthma susceptibility gene with atopic dermatitis.
15947423 2005 Characterization of GPRA, a novel G protein-coupled receptor related to asthma.
15941840 2005 Confirmation of GPRA: a putative drug target for asthma.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15764725 2005 G-Protein-coupled receptor polymorphisms are associated with asthma in a large German population.
15741670 2005 A review of asthma genetics: gene expression studies and recent candidates.
15710598 2005 Haplotypes of G protein-coupled receptor 154 are associated with childhood allergy and asthma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15312648 2004 Neuropeptide S: a neuropeptide promoting arousal and anxiolytic-like effects.
15073379 2004 Characterization of a common susceptibility locus for asthma-related traits.
14757815 2004 Elucidation of signaling properties of vasopressin receptor-related receptor 1 by using the chimeric receptor approach.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.