Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7090.53
PubTator Score 35.45

Knowledge Summary

Patent

No data available

Synonym

Accession P0C0P6
Symbols

Gene

NPS

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

 GO Component (1)

Gene RIF (12)

PMID Text
24386135 A SNP within the neuropeptide s gene is associated with decreased bioactivity.
23142110 NPS is able to stimulate human monocyte chemotaxis and that this effect is entirely due to selective NPSR activation.
20705147 NPS-NPSR1 signaling is likely involved in anxiety
20705147 Observational study of gene-disease association. (HuGE Navigator)
20405330 Observational study of gene-disease association. (HuGE Navigator)
19824051 The available information regarding NPS and its receptor and the biological actions modulated by the NPS-NPSR system, is summarized.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18376418 NPS acts as a novel modulator of arousal and anxiety-related behaviours by promoting a unique pattern of effects: stimulation associated with anxiolysis.
16926187 Because remodeling of airway epithelium is a feature of chronic asthma, the up-regulation of MMP10 and TIMP3 by NPS-NPSR1 signaling may be of relevance in the pathogenesis of asthma.
16790440 the key residues of NPS involved in NPSR activation and suggest a molecular basis for the functional effects of the N107I mutation and for its putative pathophysiological link with asthma
More...

AA Sequence

MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRS      1 - 70
FRNGVGTGMKKTSFQRAKS                                                        71 - 89
//

Text Mined References (19)

PMID Year Title
24386135 2013 A single-nucleotide polymorphism of human neuropeptide s gene originated from Europe shows decreased bioactivity.
23142110 2013 Neuropeptide S stimulates human monocyte chemotaxis via NPS receptor activation.
20705147 2010 Assessment of the neuropeptide S system in anxiety disorders.
20405330 2011 Non-synonymous polymorphism in the neuropeptide S precursor gene and sleep apnea.
19824051 2010 Neurobiology, pharmacology, and medicinal chemistry of neuropeptide S and its receptor.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18376418 2008 Neuropeptide S is a stimulatory anxiolytic agent: a behavioural study in mice.
18181564 2008 Synthesis and biological activity of human neuropeptide S analogues modified in position 2.
16926187 2006 Downstream target genes of the neuropeptide S-NPSR1 pathway.
16790440 2006 Structure-function relationships in the neuropeptide S receptor: molecular consequences of the asthma-associated mutation N107I.
More...