Property Summary

NCBI Gene PubMed Count 30
PubMed Score 22.66
PubTator Score 18.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Epilepsy, Partial, with Variable Foci 3 0.0 0.0
Schizophrenia 1136 0.0 0.0
Disease Target Count Z-score Confidence
Epilepsy 775 0.0 4.0

Expression

Gene RIF (18)

AA Sequence

MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAMEKKLIGCPVC      1 - 70
IEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFVSMEESKQKLVPIMTILLEELN     71 - 140
ASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFTKDKEDFFNSQWDLTTQQILPYIDGFRHIQKIS    141 - 210
AEADVELNLVRIAIQNLLYYGVVTLVSILQYSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRD    211 - 280
VFQLYCSLSPGTTVRDLIGRHPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHS    281 - 350
YDEICCKTGMSYHELDERLENDPNIIICWK                                            351 - 380
//

Text Mined References (30)

PMID Year Title