Property Summary

NCBI Gene PubMed Count 62
PubMed Score 186.36
PubTator Score 149.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -1.100 6.9e-04
psoriasis 1.400 1.1e-02
osteosarcoma -1.034 3.8e-02
cystic fibrosis -4.618 1.5e-08
non diabetic and post-ischemic heart fai... 1.100 4.9e-03
type II diabetes mellitus and post-ische... 1.500 2.1e-02
periodontitis -1.500 5.9e-27
atypical teratoid / rhabdoid tumor 2.100 9.6e-03
medulloblastoma, large-cell 2.000 5.1e-04
X-linked recessive Emery-Dreifuss muscul... 1.258 3.2e-03
intraductal papillary-mucinous adenoma (... -2.000 1.0e-04
intraductal papillary-mucinous carcinoma... -1.900 6.2e-04
lung cancer 1.100 1.6e-02
colon cancer -1.900 1.3e-04
pancreatic cancer 1.700 1.1e-04
breast carcinoma -1.500 2.8e-02
lung adenocarcinoma -2.400 1.9e-13
group 3 medulloblastoma 2.000 1.9e-04
lung carcinoma -2.500 1.3e-13
non-small cell lung carcinoma -1.800 8.8e-24
ductal carcinoma in situ -2.100 9.2e-03
invasive ductal carcinoma -3.100 7.6e-03
ovarian cancer 1.500 9.6e-04
Breast cancer 1.500 5.4e-03

Gene RIF (42)

PMID Text
26345810 This study focused on the natriuretic peptide receptor C gene (NPR3). The correlation analysis between NPR3 and hypertension was replicated in 450 Chinese Dai and 484 Chinese Mongolian individuals.
25736855 Results from this study point to a role for miR-100 in the regulation of NPR3 expression, and suggest a possible therapeutic target for modulation of NP bioactivity in heart disease.
25711724 Angiotensin II downregulates vascular smooth muscle cell NPR-C gene expression by destabilizing its mRNA.
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of natriuretic peptide receptor 3 (NPR3) in primary human brain microvascular endothelial cells
24465655 Data show that natriuretic peptide receptor 3 (NPR3) single nucleotide polymorphism (SNP) is independently associated with diastolic dysfunction and does not appear to be related to alterations in circulating levels of natriuretic peptides.
23493048 The significant change in NPR3 protein was observed for the Arg146 variant allozyme, with 20% of wild-type protein, primarily because of autophagy-dependent degradation.
22995222 a NPR3 promoter gene variant could have a role on cerebrovascular disease susceptibility
22559095 polymorphisms or haplotype in NPR3 gene may influence the risk of ischemic stroke or hypertension independently in Chinese population.
22421372 Report the presence of CNP and its receptors, NPR2/3 in atherosclerotic plaques of human carotid artery, with increased expression of NPR3 in histologically unstable plaques.
22001395 Results demonstrate the opposite effects of NPR-A and NPR-C in LPS-mediated endothelial permeability and lung injury.
21464461 Data found a consistent and significant association between the rs2270915 polymorphism of the NPR3 gene and SBP in diabetic patients. This genetic variation may affect pressure response to changes in dietary sodium.
20823417 integrative genomics approach to a large cohort of medulloblastomas has identified four disparate subgroups (NPR3)with distinct demographics, clinical presentation, transcriptional profiles, genetic abnormalities, and clinical outcome.
20700369 The data indicates that ANP, BNP, and CNP and natriuretic peptide receptor transcripts are expressed and are functional in human lens epithelial cells.
20691218 The mRNA levels of natriuretic peptide receptor-C appear to be increased in epicardial adipose tissue independent of their plasma levels in coronary artery disease.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19570815 results suggest that variation in the C-type natriuretic peptide signaling pathway, involving the NPPC and NPR3 genes, plays an important role in determining human body height.
19570815 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19458086 Data indicate that the familial ANP mutation associated with atrial fibrillation has only minor effects on natriuretic peptide receptor interactions but markedly modifies peptide proteolysis.
19352691 the NPR-C receptor is expressed in normal and neoplastic human alpha cells.
19343178 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19326473 Genetic variation within the NPPA/NPPB and NPR3 genes is associated with risk of VnD after primary coronary artery bypass grafting
19326473 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18633189 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17951249 Ostn is a naturally occurring ligand of the NPR-C clearance receptor and may act to locally modulate the actions of the natriuretic system in bone by blocking the clearance action of NPR-C, thus locally elevating levels of C-type natriuretic peptide.
17890443 Observational study of gene-disease association. (HuGE Navigator)
17890443 The NPRC polymorphism is not an independent determinant of NP concentration in HF.
16870210 A structural comparison of complexes of NPC-C with each NP hormones (ANP, BNP, and CNP)reveals that NPR-C uses a conformationally inflexible surface to bind three different, highly flexible, NP ligands.
15911072 discussion of NPR-C receptor coupling to different signaling pathways and their regulation [review]
15911071 model of hormone recognition and allosteric receptor activation revealed from structural studies of NPR-C [review]
15785005 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15785005 Novel six-nucleotide repeat polymorphism located 4 base pairs upstream of the major transcriptional initiation site.
15459247 Atrial natriuretic paptide, purified from medium bathing cells expressing NPR-C, a receptor known to internalize natriuretic peptides, was degraded.
15017020 Observational study of gene-disease association. (HuGE Navigator)
12872042 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12872042 The novel Npr1 gene 3C variant and the Npr3 gene C(-55) allele are associated with hypertensive family history.
12768436 Observational study of genotype prevalence. (HuGE Navigator)
11556325 protein structure: ligand binding domains

AA Sequence

MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLT      1 - 70
RVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA     71 - 140
APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLE    141 - 210
RNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT    211 - 280
SGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNM    281 - 350
EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA    351 - 420
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLEESAVTGIVVG    421 - 490
ALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSVA                       491 - 541
//

Text Mined References (63)

PMID Year Title
26345810 2015 Correlation between natriuretic peptide receptor C (NPR3) gene polymorphisms and hypertension in the Dai people of China.
25736855 2015 Natriuretic peptide receptor 3 (NPR3) is regulated by microRNA-100.
25711724 2015 Downregulation of natriuretic peptide clearance receptor mRNA in vascular smooth muscle cells by angiotensin II.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24465655 2014 A functional genetic variant (N521D) in natriuretic peptide receptor 3 is associated with diastolic dysfunction: the prevalence of asymptomatic ventricular dysfunction study.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23493048 2013 Natriuretic peptide receptor-3 gene (NPR3): nonsynonymous polymorphism results in significant reduction in protein expression because of accelerated degradation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22995222 2013 Association of a single nucleotide polymorphism of the NPR3 gene promoter with early onset ischemic stroke in an Italian cohort.
22559095 2012 Association of natriuretic peptide receptor-C gene with ischemic stroke and hypertension in Chinese Han population.
22421372 2012 C-type natriuretic peptide and its receptors in atherosclerotic plaques of the carotid artery of clinically asymptomatic patients.
22116950 2012 Genetic variants and environmental factors associated with hormonal markers of ovarian reserve in Caucasian and African American women.
22001395 2012 Opposite effects of ANP receptors in attenuation of LPS-induced endothelial permeability and lung injury.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21464461 2011 Impact of natriuretic peptide clearance receptor (NPR3) gene variants on blood pressure in type 2 diabetes.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20823417 2011 Medulloblastoma comprises four distinct molecular variants.
20700369 2010 Characterization and functional expression of the natriuretic peptide system in human lens epithelial cells.
20691218 2010 Greater expression of inflammatory cytokines, adrenomedullin, and natriuretic peptide receptor-C in epicardial adipose tissue in coronary artery disease.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19570815 2009 A genome-wide association study of northwestern Europeans involves the C-type natriuretic peptide signaling pathway in the etiology of human height variation.
19458086 2009 A familial mutation renders atrial natriuretic Peptide resistant to proteolytic degradation.
19352691 2009 C-type natriuretic peptide receptor expression in pancreatic alpha cells.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19326473 2009 Natriuretic peptide system gene variants are associated with ventricular dysfunction after coronary artery bypass grafting.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18633189 2008 Arterial stiffness, physical activity, and atrial natriuretic Peptide gene polymorphism in older subjects.
17951249 2007 Osteocrin is a specific ligand of the natriuretic Peptide clearance receptor that modulates bone growth.
17890443 2007 Influence of ScaI and natriuretic peptide (NP) clearance receptor polymorphisms of the NP System on NP concentration in chronic heart failure.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16870210 2006 Structural determinants of natriuretic peptide receptor specificity and degeneracy.
16291870 2006 Natriuretic peptides, their receptors, and cyclic guanosine monophosphate-dependent signaling functions.
15911072 2005 Natriuretic peptide receptor-C signaling and regulation.
15911071 2005 A new paradigm for hormone recognition and allosteric receptor activation revealed from structural studies of NPR-C.
15785005 2004 Variable number of tandem repeat of the 5'-flanking region of type-C human natriuretic peptide receptor gene influences blood pressure levels in obesity-associated hypertension.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459247 2005 Down-regulation does not mediate natriuretic peptide-dependent desensitization of natriuretic peptide receptor (NPR)-A or NPR-B: guanylyl cyclase-linked natriuretic peptide receptors do not internalize.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15017020 2004 Atrial natriuretic peptide gene polymorphisms and risk of ischemic stroke in humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12872042 2003 Allelic variants of natriuretic peptide receptor genes are associated with family history of hypertension and cardiovascular phenotype.
12768436 2003 Characterization of 458 single nucleotide polymorphisms of disease candidate genes in the Korean population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11556325 2001 Structural insights into the ligand binding domains of membrane bound guanylyl cyclases and natriuretic peptide receptors.
11533490 2001 Allosteric activation of a spring-loaded natriuretic peptide receptor dimer by hormone.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11181995 2001 The sequence of the human genome.
10468599 1999 Three new allelic mouse mutations that cause skeletal overgrowth involve the natriuretic peptide receptor C gene (Npr3).
8620881 1996 Structure of the 5'-flanking regulatory region of the mouse gene encoding the clearance receptor for atrial natriuretic peptide.
7996793 1994 Characterization of C-type natriuretic peptide receptors in human mesangial cells.
7901875 1993 Characterization of binding sites in rat for A, B and C-type natriuretic peptides.
7727388 1994 The disulfide linkages and glycosylation sites of the human natriuretic peptide receptor-C homodimer.
2169733 1990 Isolation and functional expression of the human atrial natriuretic peptide clearance receptor cDNA.
2162522 1990 cDNA sequence of the human atrial natriuretic peptide clearance receptor.
1979052 1990 Chromosomal distribution of three members of the human natriuretic peptide receptor/guanylyl cyclase gene family.
1660465 1991 Extracellular domain-IgG fusion proteins for three human natriuretic peptide receptors. Hormone pharmacology and application to solid phase screening of synthetic peptide antisera.
1309330 1992 Receptor selectivity of natriuretic peptide family, atrial natriuretic peptide, brain natriuretic peptide, and C-type natriuretic peptide.