Property Summary

NCBI Gene PubMed Count 229
PubMed Score 1719.78
PubTator Score 1992.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 4.0
Familial atrial fibrillation 16 0.0 4.0

Expression

  Differential Expression (8)

Gene RIF (206)

PMID Text
26801306 ANP levels rose steeply after paroxysmal supraventricular tachycardia and then reduced at 30 min after the termination.
26720342 C2238/alphaANP downregulates ApoE in vascular smooth muscle cells through type C natriuretic peptide receptor-dependent activation of Egr-1 and the consequent upregulation of miR199a.
26686590 Gene polymorphism of ANP (2238T>C) may be associated with developing preeclampsia during pregnancy.
26616294 anti-inflammatory and immunomodulatory effect on IL-1beta release and on NF-kB/NALP3/caspase-1 activation
26499263 Age-related elevation of plasma ANP levels preceded the development of CKD in the general population of Japan, raising a possibility for ANP being involved in the development of CKD.
26244664 N-terminal pro-brain natriuretic
26200358 prevalence of p.(Ser64Arg) mutation is low in the general population as is the prevalence of atrial fibrillation in mutation carriers
26074089 In this review, we discuss the role of ANP in cardiovascular biology and disease.
25917967 Our results suggest that the down-regulation of ANP gene expression at mRNA and protein levels and up-regulated CYP11B2 protein expression levels may be correlated with the essential hypertension
25864764 ANP is present in chondrocytes in all the three zones of the articular cartilage, sugesting that ANP may play a role in cartilage metabolism.
25775533 ANP prevents cancer metastasis by inhibiting the adhesion of tumor cells to inflamed endothelial cells
25452597 Circulating atrial natriuretic peptide genetic association study identifies a novel gene cluster associated with stroke in whites.
25401746 The C2238/alphaANP variant is a negative modulator of both viability and function of coronary artery smooth muscle cells.
25400811 Three NPPA-NPPB polymorphisms (rs632793, rs198388 and rs198389) were associated with reduced risk of left ventricular dysfunction in CAD patients with hyperlipidemia.
25129277 study to characterize in-depth the cardiovascular and metabolic phenotype associated with rs5068 in a cohort of heart failure patients
25123163 NPPA acts on the NPR1 receptor, is expressed in human dorsal root and trigeminal ganglia, and the spinal cord.
24973596 the contribution of ANP in different aspect of innate as well as adaptive immunity also with respect to the excessive cell growth in physiological and/or pathological conditions.
24906365 Plasma MR-proANP independently predicts all-cause mortality and MACE in patients with STEMI.
24853905 plasma mid-regional pro-atrial natriuretic peptide helps predict pre-eclampsia
24673969 Plasma ANP level was elevated in individuals with sleep disordered breathing among a large Japanese urban population.
24654911 the ANP genetic polymorphism and serum ANP levels could be potential biomarkers for early detection of ischemic stroke
24617620 CT-proAVP and MR-proANP have a significant correlation to surrogate markers of the post-cardiac arrest syndrome
24599027 Elevated levels of NPPA but not of proANP or ANP proteins in left ventricular tissue, may be due to posttranscripcional regulation of NPPA or different pathways for ANP secretion between the atrium and ventricle during heart failure.
24586593 Carriers of at least one copy of the G allele of rs5068 in NPPA had lower likelihood of incident diabetes within 14 years.
24498905 Increases in plasma ANP were related to changes in body composition induced by liraglutide in diabetic obese patients.
24487939 Presence of the rs5065 Atrial natriuretic peptide gene polymorphism is associated with reduced risk of the presence and severity of Coronary artery disease in an Iranian population, independent of the general risk factors of Coronary artery disease.
24315351 Elevated levels of atrial natriuretic factor levels at baseline predicted atrial fibrillation during a follow-up time of 16 years.
24220659 Data indicate that an 'aggregation-prone' heptapeptide ((114)KLRALLT(120)) was located within the N-terminal pro-atrial natriuretic peptide (NT-proANP) sequence.
24166646 found a significant negative association between patients' ANP plasma concentrations and anxiety, craving for alcohol and perceived stress.
24101702 Serum levels of ANP decreased during the treatment protocol for hypoplastic left heart syndrome.
24041948 The minor allele of ANP, rs5065, was associated with increased cardiovascular risk.
24030529 Heart failure patients with central sleep apnea had higher ANP concentrations. ANP was inversely related to leptin concentration.
23905909 Serum long-acting natriuretic peptide concentrations correlate positively with ankle-brachial index values among the kidney transplant patients.
23867623 MiR-425 silences NPPA mRNA in an allele-specific manner.
23799939 The findings suggest that the NPPA rs5068, or genetic variants in linkage disequilibrium, might affect susceptibility to left ventricular hypertrophy and support the possible protective role of natriuretic peptides.
23690218 Atrial natriuretic peptide (ANP) is present in both human fetal and adult parotid gland.
23637347 the G allele of rs5068 is associated with lower blood pressure, BMI, and prevalence of hypertension and metabolic syndrome in a Mediterranean population
23542086 NT-proANP and NT-proBNP are powerful markers of 30-day-mortality in patients with acute heart failure of ischemic and non-ischemic origins.
23279037 ANP increases in left ventricular volume overload irrespective of heart failure etiology. It can differentiate children in quiescent state from those in clinical failure even in the absence of echocardiographically detectable systolic dysfunction.
23275345 Autosomal recessive atrial dilated cardiomyopathy is associated with homozygous mutation of the Natriuretic Peptide. Precursor A gene
23258247 Daily walking activity independently predicts levels of circulating MRproANP and MRproADM in stable chronic obstructive pulmonary disease patients.
22981931 Mid regional-proANP showed a high diagnostic accuracy for heart failure in dyspnea patients.
22962310 Characterize an estradiol-regulated interaction of NPPA with ERalpha in cardiomyocytes.
22595807 Based on these results above, we raise the hypothesis that ANP is involved in mediating dexamethasone's inhibition of proliferation in MM cells, which suggests that ANP may be a potential agent to treat MM.
22575314 The minor allele of rs5065 atrial natriuretic peptide gene variant associates with increased susceptibility to acute coronary syndrome and has unfavorable prognostic value in coronary artery disease.
22400494 association between frequent nonsynonymous variant of NPPA and cardioembolic stroke
22370591 Results suggest the possibility of a relationship between plasma ANP levels and heart rate variability, which reflects autonomic activity.
22285803 hnRNP A1 is preferentially phosphorylated by atrial natriuretic peptide signaling which leads to co-localization of cGMP kinase and hnRNP A1 to the nucleus.
22170009 The atrial natriuretic peptide rs5065 (2238T>C) C allele seems to exert a protective effect against coronary artery disease in type 2 diabetes patients of African descent.
22113444 These findings indicate that endothelin-1 interacts with HANP and BNP in patients with chronic congestive heart failure. Endothelin-1 is suggested to play an important role in chronic congestive heart failure with preserved ejection fraction.
22112816 Low plasma levels of ANP predict development of future diabetes and glucose progression over time, suggesting a causal role of ANP deficiency in diabetes development.
21992849 Continuous infusion of low-dose human atrial natriuretic peptide during lung cancer surgery prevented postoperative atrial fibrillation after pulmonary resection in patients with preoperative elevation of B-type natriuretic peptide levels.
21952518 Plasma concentrations of all proendothelin-1, proBNP, and proANP increased on average 2- to 5-fold from birth to day 2-3 of life. The plasma concentrations of all 3 propeptides increased on average 2- to 5-fold from birth to day 2-3 of life.
21892902 proANP and NT-proBNP levels in intrauterine growth-restricted fetuses with absent and reversed end-diastolic flow of the umbilical artery in relation to ductus venosus flow velocities
21881323 Infusion of hANP during coronary artery bypass grafting in patients with chronic kidney disease improves perioperative renal function and prevents the progression of CKD.
21798427 the minor allele of rs5068 is associated with a favorable cardiometabolic profile
21757823 Myocardial protective effect of human atrial natriuretic Peptide in cardiac surgery. -hANP Shot" in clinical safety trial
21744319 The presence of Orphanin, Oxytocin, ANP, eNOS and iNOS proteins was identified in the human umbilical cord.
21741108 Study documents higher ANP concentrations as early as at 9 weeks in type 1 diabetic women subsequently developing preeclampsia suggesting that preeclampsia is associated with cardiovascular changes in early pregnancy.
21734186 The present results implicate miRs in nitric oxide and atrial natriuretic peptide signaling in general and miR-21 in particular in cGMP signaling and vascular smooth muscle cell relaxation.
21689370 Letter: report significant contributory role of NT-proANP to PAI-1 levels in adult Italian males.
21672517 These results show that ANP regulates lipid catabolism and enhances energy dissipation through AMPK activation in human adipocytes.
21600847 Comparison of atrial and brain natriuretic peptide for the assessment of mitral stenosis.
21450637 Higher circulating aldosterone and lower NT-ANP concentrations may be markers of salt sensitivity in the community.
21408188 Mid-regional pro-adrenomedullin and mid-regional pro-atrial natriuretic peptide were shown to be associated with all-cause and cardiovascular disease mortality.
21349128 Granulosa luteinized cells (GLC) are the local source of ANP in the preovulatory follicle; ANP acts as a survival factor for GLC through cGMP signaling pathways.
21276088 brain-natriuretic peptide may have a role in predicts cirrhotic cardiomyopathy in liver transplant patients
21216831 Data suggest that there may be patients for whom low corin levels and impaired pro-ANP cleavage contribute to acute decompensated heart failure.
21073007 In normal prostate, ANP is localized in glands as well as in stromal cells, so that ANP may have a role in regulating the composition of prostatic fluid as well as that of muscular tissue fluidity. [review]
20877298 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20872251 Midregional-proANP serves as a novel marker of myocardial fibrosis assessed by late gadolinium magnetic resonance imaging in patients with hypertrophic cardiomyopathy.
20726994 Up-regulation of ANP, BNP and D-dimer predict right ventricular dysfunction in patients with acute pulmonary embolism.
20700369 The data indicates that ANP, BNP, and CNP and natriuretic peptide receptor transcripts are expressed and are functional in human lens epithelial cells.
20680650 Increasing serum ANP concentrations are independently associated with hyponatremia resulting in delayed ischemic neurological deficit after aneurysmal subarachnoid hemorrhage.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20577119 Observational study of gene-disease association. (HuGE Navigator)
20543198 Common non-synonymous genetic variants within NPPA in two large North American cohorts of European ancestry are not associated with the development of atrial fibrillation
20543198 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20530040 pro-atrial natriuretic peptide and procalcitonin have roles in survival in ventilator-associated pneumonia
20453667 NT-proANP was directly associated to age, pulse pressure, renal sodium fractional excretion, and inversely to diastolic blood pressure, heart rate,creatinine clearance, body mass index,arm and leg circumferences.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20407391 Observational study of gene-disease association. (HuGE Navigator)
20368210 In type 2 diabetic males, hyperuricaemia is associated with raised ANP levels together with better beta-cell indices.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20137368 The polymorphisms of the ANP gene are not associated with increasing risk of hypertrophic cardiomyopathy or clinical phenotypes.
20064500 Variants in NPPA confer risk of lone atrial fibrillation(AF)in a Chinese population. Thus, in addition to being a disease-causing gene with mutations identified in familial AF cases, NPPA is a susceptibility gene for lone AF.
20064500 Observational study of gene-disease association. (HuGE Navigator)
20026756 the minor allele for marker rs5065 (G on the + strand) was associated with decreased asthma susceptibility
20024606 Results show that NOGCbeta1 and GC-A interact and that NOGCbeta1 regulates atrial natriuretic peptide signaling in HK-2 cells.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19845278 Results indicate that the insulin presence stimulates the ANP synthesis in pancreas of human foetuses from diabetic mothers.
19729601 Observational study of gene-disease association. (HuGE Navigator)
19729120 mutant ANP lowers blood pressure, glomerular filtration rate, and surpresses RAAS.
19702001 CC2238 alpha-ANP led to reactive oxygen species accumulation and increased expression of genes related to atherosclerosis and vascular remodeling in human umbilical vein endothelial cells.
19671135 NPPA-AS isoform is capable of down-regulating the intron-retained NPPA mRNA variant.
19646991 Data found striking functional similarities due to mutations in KCNQ1 and NPPA genes which led to I(Ks) "gain-of-function", atrial AP shortening, and consequently altered calcium current as a common mechanism between diverse familial AF syndromes.
19635983 Increased left atrial volume underlies diastolic dysfunction, so plasma concentrations of atrial natriuretic peptide, brain natriuretic peptide, and norepinephrine may be useful for risk stratification and treatment in dialysis ESRD patients.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19564455 MR-proADM, CT-proET-1, CT-proAVP, and MR-proANP were all elevated in patients with future cardiovascular events and independently correlated to serum creatinine.
19559392 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19458086 Data indicate that the familial ANP mutation associated with atrial fibrillation has only minor effects on natriuretic peptide receptor interactions but markedly modifies peptide proteolysis.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19387964 ANP decreases significantly after pacing implementation in patients selected for implantation of pacemakers.
19346663 Intravenous infusion of adrenomedullin with atrial natriuretic peptide could be used therapeutically in acute decompensated heart failure.
19330901 Only the NPPA protein remained significantly associated with incident hypertension.
19326473 Genetic variation within the NPPA/NPPB and NPR3 genes is associated with risk of VnD after primary coronary artery bypass grafting
19326473 Observational study of gene-disease association. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19238444 HuGE review of gene-disease association and gene-environment interaction. (HuGE Navigator)
19219041 Common genetic variants at the NPPA-NPPB locus found to be associated with circulating natriuretic peptide concentrations contribute to interindividual variation in blood pressure and hypertension.
19219041 Observational study of gene-disease association. (HuGE Navigator)
19155075 In chronic heart failure (CHF), tumor necrosis factor-alpha is closely related to brain natriuretic peptide and ANF(independently of CHF severity and ventricular dysfunction), particularly in patients with cardiac cachexia.
19146799 direct association between NPPA gene,ANP, and hypertension have not been entirely successful when considering the body of literature.
19141362 Carriers of ANP precursor gene alleles that are supposed to be low functional alleles excreted more potassium on hydrochlorothiazide intake than did carriers of the higher functional alleles.
19141362 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19046820 Results show significant alterations of the mRNA-expression and promoter-related DNA methylation of vasopressin and especially ANP precursor genes in patients with alcohol dependence.
19008326 ANP was not altered following passive containment surgery in heart failure patients with dilated cardiomyopathy.
18989245 Report efficacy of human atrial natriuretic peptide in patients with renal dysfunction undergoing cardiac surgery.
18855222 N-terminal proatriopeptide levels elevated in atrial septal defect, patent ductus arteriosus, coarctation of the aorta, and Mulibrey nanism
18759454 Coexpression of apoptosis signal-regulating kinase 1 (ASK1) with natriuretic peptide precursor (NPPA) in Hela cells leads to reduced levels of NPPA in the culture medium and suggests that ASK1 negatively impacts NPPA processing and/or secretion.
18713751 alternative splicing can regulate endogenous ANP/GC-A signaling
18660489 Observational study of gene-disease association. (HuGE Navigator)
18633189 ANP polymorphism in older Japanese subjects may affect the cardiovascular response to regular exercise
18633189 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18614783 In a family with 11 members with atrial fibrillation we mapped an atrial fibrillation locus to chromosome 1p36-p35 and identified a heterozygous frameshift mutation in the gene encoding atrial natriuretic peptide.
18539145 The stability of ANP in blood samples collected from healthy controls and CHF subjects for a 12 month period, was assessed.
18513389 Observational study of gene-disease association. (HuGE Navigator)
18294255 for rs5067, the risks of asthma in carriers of the C allele in the screening and replicate cohorts were reduced by 50% and 76%, respectively; NPPA may be an important susceptibility gene for asthma
18294255 Observational study of gene-disease association. (HuGE Navigator)
18280250 NT-proANP & NT-proCNP showed high values in first days of life followed by a sharp decrease & later by a progressive decrease until a plateau was reached; NT-proANP was significantly higher in infants with cardiac disease compared to non-cardiac disease
18243818 The frequency of pulses of secretion seems to be unchanged with aging. [review]
18212314 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18212314 The NPPA T2238C variant was associated with modification of antihypertensive medication effects on cardiovascular disease and blood pressure.
18172431 Significantly lower levels of ANP precursor mRNA are found in patients with bulemia nervosa. This downregulation is accompanied by hypermethylation of the ANP gene promoter in the bulimic subgroup.
18092954 Increase in CD34-positive cells may be functionally correlated with the increase in ANP production in idiopathic dilated cardiomyopathies.
17984371 natriuretic peptide precursor A gene plays a significant role in blood pressure regulation and development of hypertension.
17984371 Observational study of gene-disease association. (HuGE Navigator)
17943627 Determined plasma NT-proANP levels in relation to severity of mitral valve regurgitation.
17927564 human heart LIM promotes the specific expression of the ANF gene by co-operating with Nkx2.5
17901852 Increased ANP in patients with idiopathic hypertension may indicate the coexistence of complications with types of left ventricular hypertrophy (LVH). High concentrations of BNP may specifically suggest concentric LVH.
17900714 elevated ANP (atrial natriuretic peptide ) plasma levels are closely related to cardiac abnormalities in elderly subjects
17890485 ANP and corin are expressed at the mRNA level in human adipose tissue and preadipocytes
17890443 The ScaI polymorphism of the ANP gene might be an important additive genetic factor influencing neurohormonal activation and disease progression in severe HF.
17702963 Observational study of gene-disease association. (HuGE Navigator)
17693975 Atrial natriuretic hormone in the hypertensive subjects were lower in the Jordan Valley and lower in Irbid City than normotensives.
17672826 the -A2843G polymorphism in the ANP gene promoter might be a genetic risk factor for the development of left ventricular hypertrophy in patients with hypertension
17584735 Tbx18 interacts with Gata4 and Nkx2-5 and competes Tbx5-mediated activation of the cardiac Natriuretic peptide precursor type a-promoter. Tbx18 down-regulates Tbx6-activated Delta-like 1 expression in the somitic mesoderm in vivo
17580193 irculating ANF was strongly associated with glucose tolerance status in diabetic and nondiabetic patients in heart transplantation.
17525707 The ANP gene variant was associated with early blood pressure increase and predisposition to develop hypertension.
17460430 Observational study of gene-disease association. (HuGE Navigator)
17460430 Nppa and Npr1 gene polymorphisms are not associated with normal-tension glaucoma, suggesting that this gene does not have an important role in the pathogenesis of optic neuropathy in this disease.
17292492 NPPA in patients with myocardial infarction may be a useful parameter to guide prescription of cardiac rehabilitation.
17259761 Observational study of gene-disease association. (HuGE Navigator)
17243909 Observational study of gene-disease association. (HuGE Navigator)
17219958 Observational study of gene-disease association. (HuGE Navigator)
17051589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17036337 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16962475 Both ANP and BNP expression were higher in heart failure than in control samples.
16875975 Observational study of gene-disease association. (HuGE Navigator)
16875975 ANP/NPRA system significantly contributes to ventricular remodeling in human essential hypertension.
16721833 Observational study of gene-disease association. (HuGE Navigator)
16721833 The 664A allele of the Atrial Natriuretic Peptide(ANP) polymorphism is associated with lower levels of ApoA1 and HDL-C in Familial Hypercholesterolemia patients, but not with Coronary Artery Disease risk.
16368448 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16291573 Results suggest that atrial natriuretic factor is involved in the control of lipolysis during exercise and that it contributes to stimulation of lipolysis during repeated bouts of exercise.
16117728 Plasma concentrations of ANF were higher in children with congenital heart defects with left ventricular volume overload compared with right ventricular volume overload or pressure overload.
16113566 Polyhydramnios in fetuses with heart conditions might be explained by increased fetal diuresis secondary to increased ANP production
16100725 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15837528 Ligand- and retinoid X receptor-dependent, Vitamin D receptor-mediated suppression of human ANP gene promoter activity.
15666592 Observational study of gene-disease association. (HuGE Navigator)
15648549 Does not decrease ADH, aldosterone and corticosterone response to dehydration. Apparently modulates ADH, aldosterone and corticosterone responses to other stimuli in the dehydrated state.
15118286 In hypertrophic cardiomyopathy, plasma BNP may reflect intraventricular pressure gradient and left ventricular diastolic dysfunction. Plasma ANP reflects left ventricular diastolic dysfunction.
15111511 Observational study of gene-disease association. (HuGE Navigator)
15111511 The 2238C allele of atrial natriuretic peptide may affect the course of nephropathy in inadequately controlled type 1 diabetic patients.
15033935 In humans, in addition to catecholamines, ANP plays a noticeable role in the control of lipid mobilization. This pathway becomes of major importance when subjects are submitted to chronic treatment with a beta-blocker.
15017020 Atrial natriuretic peptide gene polymorphisms increase susceptibility for ischemic stroke.
14698679 CRH administration induced sympathotonic effects which were antagonized by ANP
12960255 ANF mediates the inhibition of TNF-alpha-induced expression of MCP-1.
12890912 Plasma ANP concentrations were significantly higher in marathon runners than in controls and judo groups, and positively correlated with the left atrial dimension index, but negatively correlated with ejection fraction.
12883099 Pro-ANP plasma levels are independently and inversely related to anxiety. This might be part of a negative feedback loop limiting psychological distress and its adverse autonomic consequences in severe heart failure.
12794112 ANP may play a role in dendritic cell (DC)-mediated immune regulation: treatment of DCs with ANP plus lipopolysaccharide promotes differentiation of naive CD4+ T cells into a Th2 phenotype.
12687344 Observational study of gene-disease association. (HuGE Navigator)
12514664 Observational study of gene-disease association. (HuGE Navigator)
12514664 The ScaI ANP polymorphism may be associated with nonfatal myocardial infarction and the extent of CAD.
12505872 results suggest that atrial natriuretic peptide can potentiate endothelial regeneration by cGMP-dependent protein kinase stimulation and subsequent Akt protein and extracellular signal-regulated kinase 1/2 activations
12484513 plasma levels of adrenomedullin, ANP and brain natriuretic peptide (BNP)increased with aging; ANP and BNP increased in association with pulse pressure; possible relation between levels and age-related changes in cardiovascular system
12270761 intrapericardial ANP may reflect the peptide concentration in the myocardial interstitium and may represent a paracrine regulatory mechanism, which seems independent of ANP-induced putative antiischemic influences
12193960 Observational study of gene-disease association. (HuGE Navigator)
12145475 expression of heart failure marker gene(ANF) are upregulated in the failing heart
12135603 Induction of IkappaB: atrial natriuretic peptide as a regulator of the NF-kappaB pathway
12102171 examination of hormones and diseases that upregulate its expression (review)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12052474 Observational study of gene-disease association. (HuGE Navigator)
11985060 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11884416 Processing of pro-atrial natriuretic peptide by corin in cardiac myocytes.
11706124 Observational study of gene-disease association. (HuGE Navigator)
11447495 Observational study of gene-disease association. (HuGE Navigator)
11409652 Observational study of gene-disease association. (HuGE Navigator)
11408388 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEA      1 - 70
GAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGA     71 - 140
QSGLGCNSFRYRR                                                             141 - 153
//

Text Mined References (230)

PMID Year Title
26801306 2016 Responses of cardiac natriuretic peptides after paroxysmal supraventricular tachycardia: ANP surges faster than BNP and CNP.
26720342 2015 C2238/?ANP modulates apolipoprotein E through Egr-1/miR199a in vascular smooth muscle cells in vitro.
26686590 2016 Analysis of the gene polymorphism of aldosterone synthase (CYP11B2) and atrial natriuretic peptide (ANP) in women with preeclampsia.
26616294 2016 Atrial natriuretic peptide down-regulates LPS/ATP-mediated IL-1? release by inhibiting NF-kB, NLRP3 inflammasome and caspase-1 activation in THP-1 cells.
26499263 2015 Plasma levels of natriuretic peptides and development of chronic kidney disease.
26244664 2015 Diagnostic Accuracy of Natriuretic Peptides for Heart Failure in Patients with Pleural Effusion: A Systematic Review and Updated Meta-Analysis.
26200358 2016 Atrial fibrillation and NPPA gene p.S64R mutation: are cardiologists helpless spectators of healthy mutation carriers?
26074089 2015 Atrial natriuretic peptide in cardiovascular biology and disease (NPPA).
25917967 2015 Atrial natriuretic peptide and aldosterone synthase gene in essential hypertension: a case-control study.
25864764 Atrial natriuretic Peptide expression in human articular cartilage.
25775533 2015 Atrial natriuretic peptide prevents cancer metastasis through vascular endothelial cells.
25452597 2015 Circulating atrial natriuretic peptide genetic association study identifies a novel gene cluster associated with stroke in whites.
25416956 2014 A proteome-scale map of the human interactome network.
25401746 2014 The C2238/?ANP variant is a negative modulator of both viability and function of coronary artery smooth muscle cells.
25400811 2014 Association of natriuretic peptide polymorphisms with left ventricular dysfunction in southern Han Chinese coronary artery disease patients.
25129277 2014 The Anp genetic variant Rs5068 and circulating levels of natriuretic peptides in patients with chronic heart failure.
25123163 2014 Itch-associated peptides: RNA-Seq and bioinformatic analysis of natriuretic precursor peptide B and gastrin releasing peptide in dorsal root and trigeminal ganglia, and the spinal cord.
24973596 2014 Atrial natriuretic peptide: an old hormone or a new cytokine?
24906365 2015 MR-proANP improves prediction of mortality and cardiovascular events in patients with STEMI.
24853905 2014 Cardiovascular biomarkers in preeclampsia at triage.
24673969 2014 Sleep-disordered breathing is associated with elevated human atrial natriuretic peptide levels in a Japanese urban population: the Suita study.
24654911 2014 Correlations of ANP genetic polymorphisms and serum levels with ischemic stroke risk: a meta-analysis.
24617620 2014 CT-proAVP (copeptin), MR-proANP and Peroxiredoxin 4 after cardiac arrest: release profiles and correlation to outcome.
24599027 2014 RNA sequencing analysis and atrial natriuretic peptide production in patients with dilated and ischemic cardiomyopathy.
24586593 2014 Atrial natriuretic peptide and type 2 diabetes development--biomarker and genotype association study.
24498905 2014 Changes in liraglutide-induced body composition are related to modifications in plasma cardiac natriuretic peptides levels in obese type 2 diabetic patients.
24487939 2014 Association between the atrial natriuretic peptide rs5065 gene polymorphism and the presence and severity of coronary artery disease in an Iranian population.
24315351 2014 Atrial natriuretic peptide as a predictor of atrial fibrillation in a male population study. The Study of Men Born in 1913 and 1923.
24220659 2014 An N-terminal pro-atrial natriuretic peptide (NT-proANP) 'aggregation-prone' segment involved in isolated atrial amyloidosis.
24166646 The impact of atrial natriuretic peptide on anxiety, stress and craving in patients with alcohol dependence.
24101702 2014 Cardiac troponin I, cardiac troponin-specific autoantibodies and natriuretic peptides in children with hypoplastic left heart syndrome.
24041948 2013 Atrial natriuretic peptide genetic variant rs5065 and risk for cardiovascular disease in the general community: a 9-year follow-up study.
24030529 2014 Leptin deficiency promotes central sleep apnea in patients with heart failure.
23905909 2013 Fasting serum long-acting natriuretic peptide correlates with the ankle brachial index in renal transplant recipients.
23867623 2013 Atrial natriuretic peptide is negatively regulated by microRNA-425.
23799939 2013 A genetic variant of the atrial natriuretic peptide gene is associated with left ventricular hypertrophy in a non-diabetic population--the Malmö preventive project study.
23690218 2013 Atrial natriuretic peptide presence in parotid gland of human fetus at 13th week of development and in adult man.
23637347 2013 The atrial natriuretic peptide genetic variant rs5068 is associated with a favorable cardiometabolic phenotype in a Mediterranean population.
23542086 2013 NT-proANP and NT-proBNP as prognostic markers in patients with acute decompensated heart failure of different etiologies.
23279037 2013 Atrial natriuretic peptide as a marker of heart failure in children with left ventricular volume overload.
23275345 2013 Autosomal recessive atrial dilated cardiomyopathy with standstill evolution associated with mutation of Natriuretic Peptide Precursor A.
23258247 2013 Associations of daily walking activity with biomarkers related to cardiac distress in patients with chronic obstructive pulmonary disease.
22981931 2012 Diagnostic power of the mid-regional pro-atrial natriuretic peptide for heart failure patients with dyspnea: a meta-analysis.
22962310 2012 17?-Estradiol-induced interaction of ER? with NPPA regulates gene expression in cardiomyocytes.
22595807 2012 Atrial natriuretic peptide: a possible mediator involved in dexamethasone's inhibition of cell proliferation in multiple myeloma.
22575314 2012 Influence of rs5065 atrial natriuretic peptide gene variant on coronary artery disease.
22400494 2012 Potential association between frequent nonsynonymous variant of NPPA and cardioembolic stroke.
22370591 2013 Relationship between status of plasma atrial natriuretic peptide and heart rate variability in human subjects.
22285803 2012 Heterogeneous nuclear ribonucleoprotein A1 is a novel cellular target of atrial natriuretic peptide signaling in renal epithelial cells.
22170009 2012 Association of 2238T>C polymorphism of the atrial natriuretic peptide gene with coronary artery disease in Afro-Caribbeans with type 2 diabetes.
22113444 2011 Endothelin-1 levels in chronic congestive heart failure.
22112816 2012 Low plasma level of atrial natriuretic peptide predicts development of diabetes: the prospective Malmo Diet and Cancer study.
21992849 2012 Effect of low-dose human atrial natriuretic peptide on postoperative atrial fibrillation in patients undergoing pulmonary resection for lung cancer: a double-blind, placebo-controlled study.
21952518 2012 Plasma C-terminal pro-endothelin-1 and the natriuretic pro-peptides NT-proBNP and MR-proANP in very preterm infants with patent ductus arteriosus.
21892902 2011 Natriuretic peptide levels in intrauterine growth-restricted fetuses with absent and reversed end-diastolic flow of the umbilical artery in relation to ductus venosus flow velocities.
21881323 2011 Low-dose atrial natriuretic peptide for chronic kidney disease in coronary surgery.
21798427 2011 A genetic variant of the atrial natriuretic peptide gene is associated with cardiometabolic protection in the general community.
21757823 2011 Myocardial protective effect of human atrial natriuretic Peptide in cardiac surgery. -hANP Shot” in clinical safety trial-.
21744319 2011 Human umbilical cord expresses several vasoactive peptides involved in the local regulation of vascular tone: protein and gene expression of Orphanin, Oxytocin, ANP, eNOS and iNOS.
21741108 2011 Atrial Natriuretic Peptide (ANP) in early pregnancy is associated with development of preeclampsia in type 1 diabetes.
21734186 2011 Implication of microRNAs in atrial natriuretic peptide and nitric oxide signaling in vascular smooth muscle cells.
21689370 2011 Aminoterminal natriuretic peptide as a determinant of PAI-1 levels in a sample of the adult male Italian population.
21672517 2011 Atrial natriuretic peptide regulates lipid mobilization and oxygen consumption in human adipocytes by activating AMPK.
21600847 2011 Comparison of atrial and brain natriuretic peptide for the assessment of mitral stenosis.
21450637 2011 Higher aldosterone and lower N-terminal proatrial natriuretic peptide as biomarkers of salt sensitivity in the community.
21408188 2011 The association of mid-regional pro-adrenomedullin and mid-regional pro-atrial natriuretic peptide with mortality in an incident dialysis cohort.
21349128 2011 Atrial natriuretic peptide is an antiapoptotic factor for human granulosa luteinized cells with impact on the results of COH/IVF in women undergoing IVF program.
21276088 2011 High brain-natriuretic peptide level predicts cirrhotic cardiomyopathy in liver transplant patients.
21216831 2011 Decompensated heart failure is associated with reduced corin levels and decreased cleavage of pro-atrial natriuretic peptide.
21073007 2010 Presence and interaction in tissues of atrial natriuretic peptide, oxytocin and vasopressin: new insights.
20877298 2012 The genetics of loop diuretic effects.
20872251 2011 Midregional pro-atrial natriuretic peptide: a novel marker of myocardial fibrosis in patients with hypertrophic cardiomyopathy.
20726994 2010 ANP, BNP and D-dimer predict right ventricular dysfunction in patients with acute pulmonary embolism.
20700369 2010 Characterization and functional expression of the natriuretic peptide system in human lens epithelial cells.
20680650 2010 Hyponatremia is predictable in patients with aneurysmal subarachnoid hemorrhage--clinical significance of serum atrial natriuretic peptide.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20577119 2010 Pharmacogenetic association of hypertension candidate genes with fasting glucose in the GenHAT Study.
20543198 2010 Evaluation of non-synonymous NPPA single nucleotide polymorphisms in atrial fibrillation.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20530040 2011 Midregional pro-atrial natriuretic peptide and procalcitonin improve survival prediction in VAP.
20453667 2010 Determinants of N-terminal proatrial natriuretic peptide plasma levels in a survey of adult male population from Southern Italy.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20407391 2010 Association of common variants in NPPA and NPPB with blood pressure does not translate into kidney damage in a general population study.
20368210 2009 Raised natriuretic peptides, big-endothelin-1 and improved beta-cell function in type 2 diabetic males with hyperuricaemia.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20137368 2010 Atrial natriuretic peptide gene polymorphism is not associated with hypertrophic cardiomyopathy.
20064500 2010 Identification of NPPA variants associated with atrial fibrillation in a Chinese GeneID population.
20026756 2010 Stronger evidence for replication of NPPA using genome-wide genotyping data.
20024606 2010 Evidence for cross-talk between atrial natriuretic peptide and nitric oxide receptors.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19845278 ANP and insulin presence in human foetal pancreas.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19729120 2009 A human atrial natriuretic peptide gene mutation reveals a novel peptide with enhanced blood pressure-lowering, renal-enhancing, and aldosterone-suppressing actions.
19702001 2009 Reactive oxygen species-mediated effects on vascular remodeling induced by human atrial natriuretic peptide T2238C molecular variant in endothelial cells in vitro.
19671135 2009 Natural antisense transcript of natriuretic peptide precursor A (NPPA): structural organization and modulation of NPPA expression.
19666519 2009 GATA6 mutations cause human cardiac outflow tract defects by disrupting semaphorin-plexin signaling.
19646991 2010 Augmented potassium current is a shared phenotype for two genetic defects associated with familial atrial fibrillation.
19635983 2009 Biomarkers of left atrial volume: a longitudinal study in patients with end stage renal disease.
19597492 2009 Variants in ZFHX3 are associated with atrial fibrillation in individuals of European ancestry.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19564455 2009 Endothelial markers may link kidney function to cardiovascular events in type 2 diabetes.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19458086 2009 A familial mutation renders atrial natriuretic Peptide resistant to proteolytic degradation.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19387964 2009 Correlation analysis of atrial natriuretic peptide concentration, echocardiographic left atrial and left ventricular dimensions, and renal function parameters in patients after permanent pacemaker implantation.
19346663 2009 Effects of long-term intravenous administration of adrenomedullin (AM) plus hANP therapy in acute decompensated heart failure: a pilot study.
19330901 2009 Association of 77 polymorphisms in 52 candidate genes with blood pressure progression and incident hypertension: the Women's Genome Health Study.
19326473 2009 Natriuretic peptide system gene variants are associated with ventricular dysfunction after coronary artery bypass grafting.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19238444 2009 The genomic basis of cerebral palsy: a HuGE systematic literature review.
19219041 2009 Association of common variants in NPPA and NPPB with circulating natriuretic peptides and blood pressure.
19155075 2010 The relationship between tumor necrosis factor-?, brain natriuretic peptide and atrial natriuretic peptide in patients with chronic heart failure.
19146799 2009 A review of the role of atrial natriuretic peptide gene polymorphisms in hypertension and its sequelae.
19141362 2010 Atrial natriuretic peptide polymorphisms, hydrochlorothiazide and urinary potassium excretion.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19046820 2009 Epigenetic regulation and gene expression of vasopressin and atrial natriuretic peptide in alcohol withdrawal.
19008326 2009 Changes in natriuretic peptides following passive containment surgery in heart failure patients with dilated cardiomyopathy.
18989245 2008 The efficacy of human atrial natriuretic peptide in patients with renal dysfunction undergoing cardiac surgery.
18855222 2009 Serum levels of natriuretic peptides in children with various types of loading conditions.
18759454 2008 Apoptosis signal-regulating kinase 1 attenuates atrial natriuretic peptide secretion.
18713751 2008 Alternative splicing of the guanylyl cyclase-A receptor modulates atrial natriuretic peptide signaling.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18633189 2008 Arterial stiffness, physical activity, and atrial natriuretic Peptide gene polymorphism in older subjects.
18614783 2008 Atrial natriuretic peptide frameshift mutation in familial atrial fibrillation.
18539145 2008 Atrial natriuretic peptide stability.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18294255 2008 A polymorphism in the NPPA gene associates with asthma.
18280250 2008 N-terminal pro A-type natriuretic peptide but not N-terminal pro C-type natriuretic peptide concentrations are related to cardiac diseases in infants.
18243818 2008 Dysregulation of pulsatility in aging IV. Pulsatile signaling and cardiovascular aging: functions and regulation of natriuretic peptide signaling.
18212314 2008 Pharmacogenetic association of the NPPA T2238C genetic variant with cardiovascular disease outcomes in patients with hypertension.
18172431 2008 Epigenetic downregulation of atrial natriuretic peptide but not vasopressin mRNA expression in females with eating disorders is related to impulsivity.
18092954 2007 Atrial natriuretic peptide and CD34 overexpression in human idiopathic dilated cardiomyopathies.
17984371 2007 Natriuretic peptide precursor a gene polymorphisms and risk of blood pressure progression and incident hypertension.
17943627 2008 Severe mitral regurgitation-relations between magnetic resonance imaging, echocardiography and natriuretic peptides.
17927564 2008 Human heart LIM protein activates atrial-natriuretic-factor gene expression by interacting with the cardiac-restricted transcription factor Nkx2.5.
17901852 2007 The concentration of atrial and brain natriuretic peptide in patients with idiopathic hypertension.
17900714 Associations between plasma natriuretic peptides and echocardiographic abnormalities in geriatric outpatients.
17890485 2007 Expression and secretion of the atrial natriuretic peptide in human adipose tissue and preadipocytes.
17890443 2007 Influence of ScaI and natriuretic peptide (NP) clearance receptor polymorphisms of the NP System on NP concentration in chronic heart failure.
17702963 2007 An interactive association of common sequence variants in the neuropeptide Y gene with susceptibility to ischemic stroke.
17693975 2007 A comparative study of plasma renin activity, aldosterone and atrial natriuretic hormone between normotensive and hypertensive people living at below sea level altitude (Jordan Valley) and those residing at moderate altitude above.
17672826 2008 Atrial natriuretic peptide gene promoter polymorphism is associated with left ventricular hypertrophy in hypertension.
17584735 2007 Transcriptional repression by the T-box proteins Tbx18 and Tbx15 depends on Groucho corepressors.
17580193 2007 Atrial natriuretic peptide in diabetic and nondiabetic patients with and without heart transplantation.
17525707 2007 Atrial natriuretic peptide (ANP) gene promoter variant and increased susceptibility to early development of hypertension in humans.
17460430 2007 Investigation of the association between normal-tension glaucoma and single nucleotide polymorphisms in natriuretic peptide gene.
17292492 2007 N-terminal pro-atrial natriuretic peptide and exercise prescription in patients with myocardial infarction.
17259761 Association between an ANF Gene I/D dimorphism and left ventricular hypertrophy in a Gulf Arab population.
17243909 2007 Association between polymorphisms of ACE, B2AR, ANP and ENOS and cardiovascular diseases: a community-based study in the Matsu area.
17219958 2006 ANP T2238C, C-664G gene polymorphism and coronary heart disease in Chinese population.
17051589 2006 Selected gene polymorphisms and their interaction with maternal smoking, as risk factors for gastroschisis.
17036337 2006 Risks of human limb deficiency anomalies associated with 29 SNPs of genes involved in homocysteine metabolism, coagulation, cell-cell interactions, inflammatory response, and blood pressure regulation.
16962475 2006 Increased expression of the renin-angiotensin system and mast cell density but not of angiotensin-converting enzyme II in late stages of human heart failure.
16875975 2006 Association of atrial natriuretic peptide and type a natriuretic peptide receptor gene polymorphisms with left ventricular mass in human essential hypertension.
16870210 2006 Structural determinants of natriuretic peptide receptor specificity and degeneracy.
16721833 2006 Natriuretic peptide Val7Met substitution and risk of coronary artery disease in Greek patients with familial hypercholesterolemia.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16368448 2005 Association between human atrial natriuretic peptide Val7Met polymorphism and baseline blood pressure, plasma trough irbesartan concentrations, and the antihypertensive efficacy of irbesartan in rural Chinese patients with essential hypertension.
16291573 2006 Atrial natriuretic peptide stimulates lipid mobilization during repeated bouts of endurance exercise.
16117728 2005 Increased plasma levels of natriuretic peptide type B and A in children with congenital heart defects with left compared with right ventricular volume overload or pressure overload.
16113566 Plasma atrial natriuretic peptide in fetuses with cardiac disease.
16100725 2005 Risks of human conotruncal heart defects associated with 32 single nucleotide polymorphisms of selected cardiovascular disease-related genes.
15837528 2005 1,25-dihydroxyvitamin D inhibits human ANP gene promoter activity.
15666592 2004 The ScaI gene polymorphism of the atrial natriuretic factor and essential arterial hypertension in childhood.
15648549 2004 Intracerebroventricular administration of atrial natriuretic peptide prevents increase of plasma ADH, aldosterone and corticosterone levels in restrained conscious dehydrated rabbits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276478 2004 Atrial natriuretic peptide modulates the hyperpolarization-activated current (If) in human atrial myocytes.
15118286 2004 Neurohumoral profiles in patients with hypertrophic cardiomyopathy: differences to hypertensive left ventricular hypertrophy.
15111511 2004 Investigation of the human ANP gene in type 1 diabetic nephropathy: case-control and follow-up studies.
15033935 2004 Atrial natriuretic peptide contributes to physiological control of lipid mobilization in humans.
15017020 2004 Atrial natriuretic peptide gene polymorphisms and risk of ischemic stroke in humans.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14698679 2003 Modulation of sympathetic activity by corticotropin-releasing hormone and atrial natriuretic peptide.
14559895 2003 Functional analysis of the transmembrane domain and activation cleavage of human corin: design and characterization of a soluble corin.
14523183 2003 Plasma concentrations of aminoterminal pro atrial natriuretic peptide and aminoterminal pro brain natriuretic peptide in healthy neonates: marked and rapid increase after birth.
12960255 2003 ANP inhibits TNF-alpha-induced endothelial MCP-1 expression--involvement of p38 MAPK and MKP-1.
12890912 2003 Differential increase in natriuretic peptides in elite dynamic and static athletes.
12883099 High plasma levels of N-terminal pro-atrial natriuretic peptide associated with low anxiety in severe heart failure.
12794112 2003 Atrial natriuretic peptide polarizes human dendritic cells toward a Th2-promoting phenotype through its receptor guanylyl cyclase-coupled receptor A.
12777209 2003 Presence of atrial natriuretic factor in normal and hyperplastic human prostate and its relationship with oxytocin localisation.
12687344 2003 Association between polymorphisms of the atrial natriuretic peptide gene and proteinuria: a population-based study.
12547834 2003 Natriuretic peptide receptor A activation stabilizes a membrane-distal dimer interface.
12514664 2003 Association of the ScaI atrial natriuretic peptide gene polymorphism with nonfatal myocardial infarction and extent of coronary artery disease.
12505872 2003 Physiological concentration of atrial natriuretic peptide induces endothelial regeneration in vitro.
12484513 2002 Plasma levels of adrenomedullin and atrial and brain natriuretic peptides in the general population: their relations to age and pulse pressure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270761 2002 Locally different role of atrial natriuretic peptide (ANP) in the pericardial fluid.
12193960 Association between an atrial natriuretic peptide gene polymorphism and normal blood pressure in subjects of African ancestry.
12190955 2002 Differential regulation of atrial and brain natriuretic peptides and its implications for the management of left ventricular volume overload.
12145475 2002 Downregulation of metabolic gene expression in failing human heart before and after mechanical unloading.
12135603 2002 Induction of IkappaB: atrial natriuretic peptide as a regulator of the NF-kappaB pathway.
12102171 2002 Atrial natriuretic peptide prohormone gene expression: hormones and diseases that upregulate its expression.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12052474 2002 Evaluation of the atrial natriuretic peptide gene in stroke.
11985060 2002 [Study of genotype frequencies of ANP 664G/A polymorphism in normal subjects and CVD patients, and its association with plasma ANP levels].
11884416 2002 Processing of pro-atrial natriuretic peptide by corin in cardiac myocytes.
11706124 2001 Atrial natriuretic peptide gene G664A polymorphism and the risk of ischemic cerebrovascular disease.
11447495 Association study of eight candidate genes with renin status in mild-to-moderate hypertension in patients of African ancestry.
11409652 2001 Association study between the variants of the human ANP gene and essential hypertension.
11408388 2001 Polymorphisms in the hANP (human atrial natriuretic peptide) gene, albuminuria, and hypertension.
10880574 2000 Corin, a transmembrane cardiac serine protease, acts as a pro-atrial natriuretic peptide-converting enzyme.
9232196 1997 Comparison of the hydrolysis of the three types of natriuretic peptides by human kidney neutral endopeptidase 24.11.
8301666 1993 Atrial natriuretic factor blocks the high-threshold Ca2+ current and increases K+ current in fetal single ventricular cells.
8043577 1994 Solution conformation of an atrial natriuretic peptide variant selective for the type A receptor.
7857923 1995 Stoichiometry of the atrial natriuretic factor-R1 receptor complex in the bovine zona glomerulosa.
6547996 1984 mRNA sequence for human cardiodilatin-atrial natriuretic factor precursor and regulation of precursor mRNA in rat atria.
6542248 1984 Nucleotide sequences of the human and mouse atrial natriuretic factor genes.
6238331 1984 Molecular cloning and characterization of DNA sequences encoding rat and human atrial natriuretic factors.
6230082 1984 Purification and complete amino acid sequence of alpha-human atrial natriuretic polypeptide (alpha-hANP).
6203042 1984 Cloning and sequence analysis of cDNA encoding a precursor for human atrial natriuretic polypeptide.
6097248 1984 Cloning of genomic DNA for human atrial natriuretic factor.
6095119 1984 Nucleotide sequence of the gene encoding human atrial natriuretic factor precursor.
6095118 1984 Gene structure of human cardiac hormone precursor, pronatriodilatin.
3158606 Molecular studies of the atrial natriuretic factor gene.
2972276 1988 Hydrolysis of alpha-human atrial natriuretic peptide in vitro by human kidney membranes and purified endopeptidase-24.11. Evidence for a novel cleavage site.
2934979 1985 The pronatriodilatin gene is located on the distal short arm of human chromosome 1 and on mouse chromosome 4.
2531377 Endopeptidase-24.11 in human plasma degrades atrial natriuretic factor (ANF) to ANF(99-105/106-126).
2169733 1990 Isolation and functional expression of the human atrial natriuretic peptide clearance receptor cDNA.
1826098 1991 Hydrolysis of intact and Cys-Phe-cleaved human atrial natriuretic peptide in vitro by human tissue kallikrein.
1672777 1991 Selective activation of the B natriuretic peptide receptor by C-type natriuretic peptide (CNP).
1660465 1991 Extracellular domain-IgG fusion proteins for three human natriuretic peptide receptors. Hormone pharmacology and application to solid phase screening of synthetic peptide antisera.
1309330 1992 Receptor selectivity of natriuretic peptide family, atrial natriuretic peptide, brain natriuretic peptide, and C-type natriuretic peptide.