Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.72
PubTator Score 9.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma -1.600 9.6e-14
oligodendroglioma -1.100 2.9e-03
glioblastoma -1.600 8.7e-08
medulloblastoma -1.700 6.9e-09
atypical teratoid / rhabdoid tumor -1.800 1.1e-10
medulloblastoma, large-cell -1.400 5.0e-04
primitive neuroectodermal tumor -1.400 2.9e-05
pediatric high grade glioma -1.400 5.3e-08
pilocytic astrocytoma -1.500 1.3e-09

Gene RIF (6)

PMID Text
22968912 Studies indicate that histone chalerones nucleoplasmin (NPM2/NPM3) preferentially associated with histones H2A-H2B in the egg and the nuclear autoantigenic sperm protein (NASP) families.
22362753 Characterization of the sperm chromatin decondensation and nucleosome assembly activities of homo- and hetero-oligomers of NPM1,NPM2 and NPM3.
21863821 The crystal structure of a truncated Npm2-core shows that the N-terminal domains of Npm2 and Np form similar pentamers, providing insights into the mechanism of histone binding by nucleoplasmins.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19491193 Promoter methylation and differential gene expression of five markers: COL1A2, NPM2, HSPB6, DDIT4L and MT1G were validated by sequencing of bisulfite-modified DNA and real-time reverse transcriptase PCR, respectively.
12209603 Expression of NPM2 in HeLa cells

AA Sequence

MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQ      1 - 70
EDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEE     71 - 140
EEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKP    141 - 210
GFKK                                                                      211 - 214
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22968912 2012 Vertebrate nucleoplasmin and NASP: egg histone storage proteins with multiple chaperone activities.
22362753 2012 Function of homo- and hetero-oligomers of human nucleoplasmin/nucleophosmin family proteins NPM1, NPM2 and NPM3 during sperm chromatin remodeling.
21863821 2011 Crystal structure and function of human nucleoplasmin (npm2): a histone chaperone in oocytes and embryos.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19491193 2009 Genome-wide screen of promoter methylation identifies novel markers in melanoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17187372 2007 New insights into the nucleophosmin/nucleoplasmin family of nuclear chaperones.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12714744 2003 Roles of NPM2 in chromatin and nucleolar organization in oocytes and embryos.
12581654 2003 Histone chaperones and nucleosome assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209603 2002 Increased expression of a COOH-truncated nucleophosmin resulting from alternative splicing is associated with cellular resistance to ionizing radiation in HeLa cells.