Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1259.17
PubTator Score 125.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.013 2.5e-02
astrocytoma 1.500 5.7e-12
atypical teratoid / rhabdoid tumor -1.100 3.4e-02
cutaneous lupus erythematosus 1.700 4.4e-03
cystic fibrosis 1.300 4.6e-03
glioblastoma 2.900 3.3e-03
group 3 medulloblastoma -1.800 3.6e-03
inflammatory breast cancer 1.500 1.1e-03
invasive ductal carcinoma 1.156 2.6e-04
lung carcinoma -1.100 1.1e-10
medulloblastoma, large-cell -1.300 1.0e-02
mucosa-associated lymphoid tissue lympho... 2.613 1.2e-02
nasopharyngeal carcinoma 1.600 1.3e-03
nephrosclerosis -1.463 1.3e-02
osteosarcoma -1.527 4.2e-04
ovarian cancer -2.300 5.4e-09
primary Sjogren syndrome 1.300 2.0e-03
subependymal giant cell astrocytoma 1.479 2.2e-02
tuberculosis 1.100 3.7e-05

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW      1 - 70
VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF     71 - 140
YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM    141 - 210
GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP    211 - 280
PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS                                  281 - 320
//

Text Mined References (11)

PMID Year Title