Property Summary

NCBI Gene PubMed Count 133
PubMed Score 375.71
PubTator Score 237.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -2.100 3.5e-02
osteosarcoma 1.711 2.5e-07
psoriasis 1.100 6.8e-04

Gene RIF (134)

AA Sequence

MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGRAGTPGEPRAPAATVVDVDEV      1 - 70
RGSGEEGTEVVALLESERPEEGTKSSGLGACEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLG     71 - 140
HLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHV    141 - 210
SKAVQFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAV    211 - 280
EAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCL    281 - 350
SSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML                                         351 - 383
//

Text Mined References (136)

PMID Year Title