Property Summary

NCBI Gene PubMed Count 20
PubMed Score 319.62
PubTator Score 67.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (6)

AA Sequence

MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFL      1 - 70
FQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK                                71 - 113
//

Text Mined References (22)

PMID Year Title