Property Summary

Ligand Count 1
NCBI Gene PubMed Count 30
PubMed Score 407.30
PubTator Score 770.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
esophageal adenocarcinoma -1.400 1.8e-02
group 3 medulloblastoma 1.400 3.4e-03
intraductal papillary-mucinous carcinoma... 1.200 4.0e-03
lung adenocarcinoma 1.184 2.3e-07
osteosarcoma 1.122 2.8e-04
ovarian cancer -1.900 1.3e-08
psoriasis -1.500 9.1e-05
spina bifida -1.259 3.3e-02

Gene RIF (9)

AA Sequence

MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSPINYSLCLKPD      1 - 70
LLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTG     71 - 140
TGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDEPAIKATFDISLVVPKDR    141 - 210
VALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKF    211 - 280
ALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVV    281 - 350
GHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE    351 - 420
VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWESLENASGKPI    421 - 490
AAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGGSYVGEDCPQWMVPITISTSEDPNQAKLKIL    491 - 560
MDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGI    561 - 630
ISTVEVLKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGH    631 - 700
LDALLRGLVLGKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA    701 - 770
DMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN    771 - 840
RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLL    841 - 910
QRKASPPTV                                                                 911 - 919
//

Text Mined References (38)

PMID Year Title