Property Summary

NCBI Gene PubMed Count 30
PubMed Score 371.87
PubTator Score 770.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
esophageal adenocarcinoma -1.400 1.8e-02
psoriasis -1.500 9.1e-05
osteosarcoma -1.137 6.9e-04
intraductal papillary-mucinous carcinoma... 1.200 4.0e-03
group 3 medulloblastoma 1.400 3.4e-03
lung adenocarcinoma 1.184 2.3e-07
spina bifida -1.259 3.3e-02
ovarian cancer 2.600 1.7e-06

Gene RIF (9)

PMID Text
26078706 cytosolic peptidases(puromycin-sensitive aminopeptidase (PSA), aminopeptidase B (APB) and pyroglutamyl-peptidase I (PGI) ) may be involved in colorectal carcinogenesis
25342037 MiR-614 inhibited cell invasion and proliferationa targeting PSA in lung cancer cells, PGCL3
25142031 Studies indicate the critical role of M1 aminopeptidases ERAP1, ERAP2 and NPEPPS in immune-mediated diseases.
22944692 Positional proteomics analysis identifies the cleavage of human aminopeptidase puromycin sensitive (NPEPPS) at amino acid residues 677-678 by the HIV-1 protease
21320871 Elevation of NPEPPS activity blocks accumulation of hyperphosphorylated TAU protein and slows down the progression of Alzheimer's disease.
20829225 findings show that by promoting autophagic protein clearance, PSA helps protect against accumulation of aggregation-prone proteins and proteotoxicity
20377816 attenuated proteolysis of FTDP-17 mutant tau may be explained by increased phosphorylation levels, resulting in resistance to proteolysis.
19494703 PSA gene was downregulated in PC-3 cells that were treated with CoCl(2). PSA is involved in the proliferation, migration, and invasion of PC-3 cells, which are important determinants of metastasis, via a mechanism that involves MMP-9 modulation.
14706550 ApPS Y394F exhibited a 3.3-fold lower affinity for RB-3014, a transition state inhibitor, indicating that Tyr394 is involved in transition state stabilization

AA Sequence

MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSPINYSLCLKPD      1 - 70
LLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTG     71 - 140
TGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDEPAIKATFDISLVVPKDR    141 - 210
VALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKF    211 - 280
ALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVV    281 - 350
GHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE    351 - 420
VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWESLENASGKPI    421 - 490
AAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGGSYVGEDCPQWMVPITISTSEDPNQAKLKIL    491 - 560
MDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGI    561 - 630
ISTVEVLKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGH    631 - 700
LDALLRGLVLGKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA    701 - 770
DMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN    771 - 840
RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLL    841 - 910
QRKASPPTV                                                                 911 - 919
//

Text Mined References (38)

PMID Year Title
26078706 2015 Altered Activity and Expression of Cytosolic Peptidases in Colorectal Cancer.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25342037 2014 [MiR-614 inhibited lung cancer cell invasion and proliferation via targeting PSA].
25142031 2014 Genetic associations and functional characterization of M1 aminopeptidases and immune-mediated diseases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24234648 2014 No evidence for shared genetic basis of common variants in multiple sclerosis and amyotrophic lateral sclerosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21320871 2011 Puromycin-sensitive aminopeptidase (PSA/NPEPPS) impedes development of neuropathology in hPSA/TAU(P301L) double-transgenic mice.
21269460 2011 Initial characterization of the human central proteome.
21056661 2011 Hypoxia enhances transcriptional activity of androgen receptor through hypoxia-inducible factor-1? in a low androgen environment.
20829225 2010 Puromycin-sensitive aminopeptidase protects against aggregation-prone proteins via autophagy.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20377816 2009 Involvement of puromycin-sensitive aminopeptidase in proteolysis of tau protein in cultured cells, and attenuated proteolysis of frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17) mutant tau.
19917696 2009 Cytosolic aminopeptidases influence MHC class I-mediated antigen presentation in an allele-dependent manner.
19494703 2009 Cobalt chloride-induced downregulation of puromycin-sensitive aminopeptidase suppresses the migration and invasion of PC-3 cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17318184 2007 Puromycin-sensitive aminopeptidase is the major peptidase responsible for digesting polyglutamine sequences released by proteasomes during protein degradation.
17154549 2006 Degradation of tau protein by puromycin-sensitive aminopeptidase in vitro.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706550 2003 Analysis of conserved residues of the human puromycin-sensitive aminopeptidase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12729622 2003 Mutation of active site residues of the puromycin-sensitive aminopeptidase: conversion of the enzyme into a catalytically inactive binding protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435692 2001 Human puromycin-sensitive aminopeptidase: cloning of 3' UTR, evidence for a polymorphism at a.a. 140 and refined chromosomal localization to 17q21.
11062501 2000 Two new proteases in the MHC class I processing pathway.
10978616 2000 Puromycin-sensitive alanyl aminopeptidase from human liver cytosol: purification and characterization.
10582526 1999 Ontogeny of puromycin-sensitive and insensitive aminopeptidase activities in several subcellular fractions of the rat brain.
10329370 1999 Cloning and analysis of the gene for the human puromycin-sensitive aminopeptidase.
10037494 1999 cDNA cloning and molecular characterization of human brain metalloprotease MP100: a beta-secretase candidate?
9668046 1998 Interferon-gamma can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase.
9048733 1997 Cloning of the human puromycin-sensitive aminopeptidase and evidence for expression in neurons.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8082751 1994 Immunocytochemical comparison of cultured normal epithelial prostatic cells with prostatic tissue sections.
7592939 1995 Puromycin-sensitive aminopeptidase. Sequence analysis, expression, and functional characterization.
3171591 1988 Studies on the tissue distribution of the puromycin-sensitive enkephalin-degrading aminopeptidases.