Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.06
PubTator Score 475.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 1 16 3.414 1.7

Expression

Synonym

Accession Q9NQX5 Q5SPY8 Q9BTD6 Q9BXT3 Q9NQS2 Q9Y434 NPDC-1
Symbols CAB
CAB-
CAB1
CAB-1
NPDC-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
15563841 Human gene mapped to chromosome 9q34.3.
15229225 NPDC-1 has a role in regulating neuronal proliferation and is degraded by the ubiquitin/proteasome system through a PEST degradation motif

AA Sequence

MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPF      1 - 70
QEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGL     71 - 140
ELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQ    141 - 210
REIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEEN    211 - 280
EDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP                             281 - 325
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15563841 2004 Functional analysis of the NPDC-1 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15229225 2004 NPDC-1, a novel regulator of neuronal proliferation, is degraded by the ubiquitin/proteasome system through a PEST degradation motif.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11245976 2001 Characterization and tissue expression of a novel human gene npdc1.
11042687 2000 NPDC-1, a regulator of neural cell proliferation and differentiation, interacts with E2F-1, reduces its binding to DNA and modulates its transcriptional activity.
10970871 2000 The Rab3 GDP/GTP exchange factor homolog AEX-3 has a dual function in synaptic transmission.
9181131 1997 [Identification of NPDC-1, gene involved in the control of proliferation and differentiation of neural and glial precursors].
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7878019 1995 Identification of a neural-specific cDNA, NPDC-1, able to down-regulate cell proliferation and to suppress transformation.