Property Summary

NCBI Gene PubMed Count 72
PubMed Score 173.50
PubTator Score 163.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
NIEMANN-PICK DISEASE, TYPE C2 1 0.0 0.0
Disease Target Count Z-score Confidence
Niemann-Pick disease 14 7.343 3.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 3.194 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.800 2.4e-02
Astrocytoma, Pilocytic 1.500 6.3e-07
atypical teratoid / rhabdoid tumor 1.300 2.4e-04
Down syndrome 1.100 1.3e-03
Duchenne muscular dystrophy 1.263 1.0e-09
ependymoma 1.100 2.2e-05
glioblastoma 2.800 2.7e-05
intraductal papillary-mucinous carcinoma... -1.100 8.5e-04
intraductal papillary-mucinous neoplasm ... -1.100 5.2e-03
lung cancer -2.000 7.5e-04
lung carcinoma -2.200 6.1e-34
medulloblastoma, large-cell -1.100 3.2e-05
ovarian cancer -1.900 2.6e-06
pediatric high grade glioma 1.400 1.6e-03
subependymal giant cell astrocytoma 2.513 1.0e-02

 IMPC Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (55)

AA Sequence

MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSS      1 - 70
KAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFC     71 - 140
WEIPVQIVSHL                                                               141 - 151
//

Text Mined References (82)

PMID Year Title