Property Summary

NCBI Gene PubMed Count 36
PubMed Score 432.85
PubTator Score 120.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 4.8e-06
malignant mesothelioma 3163 7.6e-06
acute myeloid leukemia 785 4.9e-02
Disease Target Count Z-score Confidence
Facial neuralgia 3 4.202 2.1
Ataxia telangiectasia 32 3.762 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.800 7.6e-06
osteosarcoma 2.421 4.8e-06
acute myeloid leukemia -1.500 4.9e-02

Gene RIF (21)

PMID Text
26429916 Cpn10 has a role in the spatial regulation of NPAT signaling
25339177 The conserved C-terminal domain shared by FLASH, YARP, and Mute recognizes the C-terminal sequence of NPAT orthologues, thus acting as a signal targeting proteins to histone locus bodies.
21562039 NPAT is thus far the first gene implicated in nodular lymphocyte predominant Hodgkin lymphoma predisposition.
21050672 Genetic variants of NPAT-ATM and AURKA are associated with an individual early adverse reaction in the gastrointestinal tract of patients with cervical cancer treated with pelvic radiation therapy
21050672 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20190802 NPAT is essential for histone mRNA 3' end processing and recruits CDK9 to replication-dependent histone genes.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890848 Cyclin D2 and the CDK substrate p220(NPAT) are required for self-renewal of human embryonic stem cells.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19277982 The subnuclear organization of histone gene regulatory proteins and 3' end processing factors (NPAT/LSM10) of normal somatic and embryonic stem cells is compromised in selected human cancer cell types.
19170105 Results suggest that cyclin-dependent kinase inhibitors selectively control stimulation of the histone H4 gene promoter by the p220(NPAT)/HiNF-P complex.
18677100 Only the number of FLASH/NPAT histone gene locus bodies correlates with ploidy and only these organelles appear to be regulated during the cell cycle.
17974976 HiNF-P/P220NPAT regulates expression of nonhistone targets that influence competency for cell cycle progression.
17967892 NPAT recruits the TRRAP-Tip60 complex to histone gene promoters to coordinate the transcriptional activation of multiple histone genes during the G(1)/S-phase transition
17449237 NPAT, together with CUL5 and PPP2R1B, is implicated in the deregulation of the cell-cycle and apoptosis regulators and in the pathogenesis of B-CLL.
14612403 p220 is an essential downstream component of the cyclin E/Cdk2 signaling pathway and functions to coordinate multiple elements of the G1/S transition.
12887926 OCA-S, the multicomponent Oct-1 coactivator, intercts with NPAT.
12724424 the ability of p220 to promote S phase is independent of its ability to promote histone H4 transcription and p220 may link cyclin E/Cdk2 to multiple independent downstream functions
12665581 NPAT links E2F to the activation of S-phase-specific histone gene transcription.
12473189 Results characterize the functional signals required for NPAT localization to the cell nucleus.

AA Sequence

MLLPSDVARLVLGYLQQENLISTCQTFILESSDLKEYAEHCTDEGFIPACLLSLFGKNLTTILNEYVAMK      1 - 70
TKETSNNVPAIMSSLWKKLDHTLSQIRSMQSSPRFAGSQRARTRTGIAEIKRQRKLASQTAPASAELLTL     71 - 140
PYLSGQFTTPPSTGTQVTRPSGQISDPSRSYFVVVNHSQSQDTVTTGEALNVIPGAQEKKAHASLMSPGR    141 - 210
RKSESQRKSTTLSGPHSTIRNFQDPNAFAVEKQMVIENAREKILSNKSLQEKLAENINKFLTSDNNIAQV    211 - 280
PKQTDNNPTEPETSIDEFLGLPSEIHMSEEAIQDILEQTESDPAFQALFDLFDYGKTKNNKNISQSISSQ    281 - 350
PMESNPSIVLADETNLAVKGSFETEESDGQSGQPAFCTSYQNDDPLNALKNSNNHDVLRQEDQENFSQIS    351 - 420
TSIQKKAFKTAVPTEQKCDIDITFESVPNLNDFNQRGNSNAECNPHCAELYTNQMSTETEMAIGIEKNSL    421 - 490
SSNVPSESQLQPDQPDIPITSFVSLGCEANNENLILSGKSSQLLSQDTSLTGKPSKKSQFCENSNDTVKL    491 - 560
KINFHGSKSSDSSEVHKSKIEINVLEPVMSQLSNCQDNSCLQSEILPVSVESSHLNVSGQVEIHLGDSLS    561 - 630
STKQPSNDSASVELNHTENEAQASKSENSQEPSSSVKEENTIFLSLGGNANCEKVALTPPEGTPVENSHS    631 - 700
LPPESVCSSVGDSHPESQNTDDKPSSNNSAEIDASNIVSLKVIISDDPFVSSDTELTSAVSSINGENLPT    701 - 770
IILSSPTKSPTKNAELVKCLSSEETVGAVVYAEVGDSASMEQSLLTFKSEDSAVNNTQNEDGIAFSANVT    771 - 840
PCVSKDGGYIQLMPATSTAFGNSNNILIATCVTDPTALGTSVSQSNVVVLPGNSAPMTAQPLPPQLQTPP    841 - 910
RSNSVFAVNQAVSPNFSQGSAIIIASPVQPVLQGMVGMIPVSVVGQNGNNFSTPPRQVLHMPLTAPVCNR    911 - 980
SIPQFPVPPKSQKAQGLRNKPCIGKQVNNLVDSSGHSVGCHAQKTEVSDKSIATDLGKKSEETTVPFPEE    981 - 1050
SIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTLKPPSNNAIKREKE   1051 - 1120
KPPLPKILSKSESAISRHTTIRETQSEKKVSPTEIVLESFHKATANKENELCSDVERQKNPENSKLSIGQ   1121 - 1190
QNGGLRSEKSIASLQEMTKKQGTSSNNKNVLSVGTAVKDLKQEQTKSASSLITTEMLQDIQRHSSVSRLA   1191 - 1260
DSSDLPVPRTPGSGAGEKHKEEPIDIIKAPSSRRFSEDSSTSKVMVPPVTPDLPACSPASETGSENSVNM   1261 - 1330
AAHTLMILSRAAISRTTSATPLKDNTQQFRASSRSTTKKRKIEELDERERNSRPSSKNLTNSSIPMKKKK   1331 - 1400
IKKKKLPSSFPAGMDVDKFLLSLHYDE                                              1401 - 1427
//

Text Mined References (52)

PMID Year Title
26429916 2015 Interaction of Heat Shock Protein Cpn10 with the Cyclin E/Cdk2 Substrate Nuclear Protein Ataxia-Telangiectasia (NPAT) Is Involved in Regulating Histone Transcription.
25339177 2014 A conserved interaction that is essential for the biogenesis of histone locus bodies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21562039 2011 Exome sequencing reveals germline NPAT mutation as a candidate risk factor for Hodgkin lymphoma.
21050672 2011 Genetic variants of NPAT-ATM and AURKA are associated with an early adverse reaction in the gastrointestinal tract of patients with cervical cancer treated with pelvic radiation therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20190802 2010 Induced G1 cell-cycle arrest controls replication-dependent histone mRNA 3' end processing through p21, NPAT and CDK9.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890848 2010 Cyclin D2 and the CDK substrate p220(NPAT) are required for self-renewal of human embryonic stem cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19277982 2009 The subnuclear organization of histone gene regulatory proteins and 3' end processing factors of normal somatic and embryonic stem cells is compromised in selected human cancer cell types.
19170105 2009 CDK inhibitors selectively diminish cell cycle controlled activation of the histone H4 gene promoter by p220NPAT and HiNF-P.
18850719 2008 The histone gene cell cycle regulator HiNF-P is a unique zinc finger transcription factor with a novel conserved auxiliary DNA-binding motif.
18677100 2008 FLASH and NPAT positive but not Coilin positive Cajal Bodies correlate with cell ploidy.
17974976 2007 The HiNF-P/p220NPAT cell cycle signaling pathway controls nonhistone target genes.
17967892 2008 Transcriptional activation of histone genes requires NPAT-dependent recruitment of TRRAP-Tip60 complex to histone promoters during the G1/S phase transition.
17826007 2007 Transcriptional activation of the histone nuclear factor P (HiNF-P) gene by HiNF-P and its cyclin E/CDK2 responsive co-factor p220NPAT defines a novel autoregulatory loop at the G1/S phase transition.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17520687 2007 Cell cycle dependent phosphorylation and subnuclear organization of the histone gene regulator p220(NPAT) in human embryonic stem cells.
17449237 2007 Analysis of 11q22-q23 deletion target genes in B-cell chronic lymphocytic leukaemia: evidence for a pathogenic role of NPAT, CUL5, and PPP2R1B.
17163457 2007 HiNF-P is a bifunctional regulator of cell cycle controlled histone H4 gene transcription.
17096384 2007 Establishment of histone gene regulation and cell cycle checkpoint control in human embryonic stem cells.
17068332 2006 Deficiency of the zinc finger protein ZPR1 causes defects in transcription and cell cycle progression.
17003125 2006 FLASH is required for histone transcription and S-phase progression.
16972248 2006 Self-renewal of human embryonic stem cells is supported by a shortened G1 cell cycle phase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16131487 2005 Coordinate control and selective expression of the full complement of replication-dependent histone H4 genes in normal and cancer cells.
15988025 2005 HiNF-P directly links the cyclin E/CDK2/p220NPAT pathway to histone H4 gene regulation at the G1/S phase cell cycle transition.
15555599 2004 Dynamic interaction of p220(NPAT) and CBP/p300 promotes S-phase entry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14976556 2004 DNA damage induces downregulation of histone gene expression through the G1 checkpoint pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612403 2003 The cyclin E/Cdk2 substrate p220(NPAT) is required for S-phase entry, histone gene expression, and Cajal body maintenance in human somatic cells.
14585971 2003 Identification of HiNF-P, a key activator of cell cycle-controlled histone H4 genes at the onset of S phase.
12887926 2003 S phase activation of the histone H2B promoter by OCA-S, a coactivator complex that contains GAPDH as a key component.
12724424 2003 The cyclin E/Cdk2 substrate and Cajal body component p220(NPAT) activates histone transcription through a novel LisH-like domain.
12665581 2003 NPAT expression is regulated by E2F and is essential for cell cycle progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473189 2002 Characterization of functional regions for nuclear localization of NPAT.
12032824 2002 Aberrant methylation of the ATM promoter correlates with increased radiosensitivity in a human colorectal tumor cell line.
10995387 2000 Cell cycle-regulated phosphorylation of p220(NPAT) by cyclin E/Cdk2 in Cajal bodies promotes histone gene transcription.
10995386 2000 NPAT links cyclin E-Cdk2 to the regulation of replication-dependent histone gene transcription.
9472014 1998 Expression of NPAT, a novel substrate of cyclin E-CDK2, promotes S-phase entry.
9205109 1997 The structure and organization of the human NPAT gene.
9199932 1997 Ataxia-telangiectasia locus: sequence analysis of 184 kb of human genomic DNA containing the entire ATM gene.
9060412 1997 CAND3: a ubiquitously expressed gene immediately adjacent and in opposite transcriptional orientation to the ATM gene at 11q23.1.
8923007 1996 A gene transcribed from the bidirectional ATM promoter coding for a serine rich protein: amino acid sequence, structure and expression studies.
8789452 1996 Mutations revealed by sequencing the 5' half of the gene for ataxia telangiectasia.
8743993 1996 Identification and characterization of a new gene physically linked to the ATM gene.