Property Summary

NCBI Gene PubMed Count 53
PubMed Score 73.85
PubTator Score 60.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -4.600 2.4e-08
astrocytic glioma -2.200 1.5e-03
ependymoma -1.800 2.7e-03
oligodendroglioma -1.600 4.4e-03
psoriasis -1.400 6.3e-04
osteosarcoma 1.424 2.7e-05
sonic hedgehog group medulloblastoma -2.800 5.5e-04
atypical teratoid / rhabdoid tumor -1.900 7.8e-03
medulloblastoma, large-cell -3.700 1.8e-05
primitive neuroectodermal tumor -1.800 9.9e-03
intraductal papillary-mucinous neoplasm ... 1.200 8.1e-03
colon cancer 1.900 3.1e-05
Breast cancer 2.200 4.0e-02
interstitial cystitis -2.300 1.7e-04
adult high grade glioma -1.100 1.1e-03
lung carcinoma 2.300 7.5e-22
spina bifida -1.683 1.7e-02
ovarian cancer 1.500 1.7e-04
pituitary cancer -1.800 1.3e-03

Protein-protein Interaction (6)

Gene RIF (44)

PMID Text
26134245 CLOCK, ARNTL, and NPAS2 gene polymorphisms may have a role in seasonal variations in mood and behavior
25989161 Genetic variations in NPAS2 might be a biomarker for a seasonal pattern in bipolar disorders.
25956372 With whole-exome sequencing a novel mutation in NPAS2 was identified in a Turkish family with nonobstructive azoospermia.
25227809 NPAS2 rs2305160 polymorphism does not appear to have any association with risk of chronic lymphocytic leukemia in our Pakistani population.
24978311 NPAS2, functioned as a potential tumor suppressor gene, could serve as a promising target and potential prognostic indicator for colorectal cancer.
24919398 Two single nucleotide polymorphisms in RORA were associated with breast cancer in the whole sample and among postmenopausal women, and we also reported an association with CLOCK, RORA, and NPAS2 in the analyses at the gene level
24824748 distributions of allelic, genotypic, and haplotypic variants of NPAS2 (rs2305160 and rs6725296) were not significantly different between schizophrenic patients with and without RLS
24754267 Functional rs1053096 and rs2305160 polymorphisms in the NPAS2 gene are associated with overall survival in transcatheter arterial chemoembolization-treated hepatocellular carcinoma patients.
23449886 Variants in NPAS2 have been associated with seasonality and seasonal affective disorder, phenotypes that could reflect circadian rhythm disruption.
22538398 Genetic variants of NPAS2 associate with seasonal affective disorder or winter depression.
21912186 Convergent functional genomics allowed the identification of novel candidate genes, GRIK2 and NPAS2, involved in glutamatergic neurotransmission and the circadian rhythm, respectively, that are potentially associated with CFS.
21140207 found a novel functional SNP (rs3739008) located at 3'UTR of NPAS2 and the C to T changing of the SNP may disrupt the binding of microRNA- (miR-) 17-5p and miR-519e to the 3'UTR of NPAS2
20817722 Data demonstrate that NPAS2 is also a RORalpha and REV-ERBalpha target gene.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20368993 ARNTL and NPAS2 SNPs were associated with reproduction and with seasonal variation.
20368993 Observational study of gene-disease association. (HuGE Navigator)
20180986 Observational study of gene-disease association. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
20149345 Observational study of gene-disease association. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20072116 Observational study of gene-disease association. (HuGE Navigator)
19934327 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19693801 Observational study of gene-disease association. (HuGE Navigator)
19649706 A high level of NPAS2 expression was strongly associated with improved disease free survival & overall survival. The Ala/Ala, Ala/Thr, & Thr/Thr genotypes were also differentially distributed by tumor severity, as measured by TNM classification.
19649706 Observational study of gene-disease association. (HuGE Navigator)
19470168 Observational study of gene-disease association. (HuGE Navigator)
19457610 The 1st list of direct transcriptional targets of NPAS2 comprises 26 genes that contain potential NPAS2 binding regions, 9 of which are involved in tumorigenesis.
18990770 Variations in circadian genes are associated with serum levels of androgens and IGF markers, particularly NPAS2 rs2305160:G>A(Ala394Thr).
18990770 Observational study of gene-disease association. (HuGE Navigator)
18819933 knockdown of NPAS2 significantly represses the expression of several cell cycle and DNA repair genes in breast and colorectal neoplasms.
17984998 Observational study of gene-disease association. (HuGE Navigator)
17457720 variations associated with seasonal affective disorder
17453337 a role of the circadian gene NPAS2 in human breast cancer, suggesting that genetic variations in circadian genes might be a novel panel of biomarkers for breast cancer risk.
17453337 Observational study of gene-disease association. (HuGE Navigator)
17264841 Observational study of gene-disease association. (HuGE Navigator)
17264841 With autisitc disorder, haplotype analysis of two-marker haplotypes showed that in npas2 40 out of the 136 possible two-marker combinations were significant, with the best result between markers rs1811399 and rs2117714.
17096334 Observational study of gene-disease association. (HuGE Navigator)
17096334 Our results demonstrate a robust association of the variant Thr genotypes (Ala/Thr and Thr/Thr) with reduced risk of non-Hodgkin's lymphoma.
16628007 the CLOCK(NPAS2)/BMAL1 complex is post-translationally regulated by cry1 and cry2
16528748 Observational study of gene-disease association. (HuGE Navigator)
12655319 A significant difference between patients with seasonal affective disorder (SAD) and controls is found for NPAS2 protein (471 Leu/Ser) indicating a recessive effect of the leucine allele on SAD susceptibility.

AA Sequence

MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICD      1 - 70
IQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSE     71 - 140
VYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDN    141 - 210
TLSRPCRVPLGKEVCFIATVRLATPQFLKEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVL    211 - 280
GTSGYDYYHIDDLELLARCHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSV    281 - 350
VSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH    351 - 420
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLLPQTVLQSTPA    421 - 490
PMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQMFLQQPAVSLSFSSTQR    491 - 560
PEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLLRESSVISTQGPKPMRSSQLMQSSGRSGSSL    561 - 630
VSPFSSATAALPPSLNLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTG    631 - 700
RQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTS    701 - 770
LHSEQQDSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR                    771 - 824
//

Text Mined References (56)

PMID Year Title
26134245 2015 Association of CLOCK, ARNTL, and NPAS2 gene polymorphisms and seasonal variations in mood and behavior.
25989161 2015 Genetic association study of circadian genes with seasonal pattern in bipolar disorders.
25956372 2015 Whole-exome sequencing identifies novel homozygous mutation in NPAS2 in family with nonobstructive azoospermia.
25227809 2014 Lack of association of the NPAS2 gene Ala394Thr polymorphism (rs2305160:G>A) with risk of chronic lymphocytic leukemia.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24978311 2014 Silencing NPAS2 promotes cell growth and invasion in DLD-1 cells and correlated with poor prognosis of colorectal cancer.
24919398 2014 Breast cancer risk, nightwork, and circadian clock gene polymorphisms.
24824748 2014 Association between restless legs syndrome and CLOCK and NPAS2 gene polymorphisms in schizophrenia.
24754267 2014 Functional polymorphisms in the NPAS2 gene are associated with overall survival in transcatheter arterial chemoembolization-treated hepatocellular carcinoma patients.
23449886 2013 Common genetic variants in ARNTL and NPAS2 and at chromosome 12p13 are associated with objectively measured sleep traits in the elderly.
23303907 2013 Metabolism and the circadian clock converge.
22593554 2012 Observation of dually decoded regions of the human genome using ribosome profiling data.
22538398 2012 Clock gene variants in mood and anxiety disorders.
22137330 2012 Genome-wide study links MTMR7 gene to variant Creutzfeldt-Jakob risk.
21912186 2011 Convergent genomic studies identify association of GRIK2 and NPAS2 with chronic fatigue syndrome.
21140207 2011 A variant affecting miRNAs binding in the circadian gene Neuronal PAS domain protein 2 (NPAS2) is not associated with breast cancer risk.
20817722 2010 Characterization of the core mammalian clock component, NPAS2, as a REV-ERBalpha/RORalpha target gene.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20368993 2010 ARNTL (BMAL1) and NPAS2 gene variants contribute to fertility and seasonality.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20149345 2010 CLOCK gene variants associate with sleep duration in two independent populations.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
19934327 2009 Testing the circadian gene hypothesis in prostate cancer: a population-based case-control study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19649706 2010 The circadian gene NPAS2 is a novel prognostic biomarker for breast cancer.
19470168 2009 NPAS2 and PER2 are linked to risk factors of the metabolic syndrome.
19457610 2009 Cancer-related transcriptional targets of the circadian gene NPAS2 identified by genome-wide ChIP-on-chip analysis.
18990770 2008 Correlation between circadian gene variants and serum levels of sex steroids and insulin-like growth factor-I.
18819933 2008 The circadian gene NPAS2, a putative tumor suppressor, is involved in DNA damage response.
18439826 2008 Regulation of monoamine oxidase A by circadian-clock components implies clock influence on mood.
17984998 2008 Variants in circadian genes and prostate cancer risk: a population-based study in China.
17457720 2007 Three circadian clock genes Per2, Arntl, and Npas2 contribute to winter depression.
17453337 2008 Non-synonymous polymorphisms in the circadian gene NPAS2 and breast cancer risk.
17264841 2007 Association of Per1 and Npas2 with autistic disorder: support for the clock genes/social timing hypothesis.
17096334 2007 Ala394Thr polymorphism in the clock gene NPAS2: a circadian modifier for the risk of non-Hodgkin's lymphoma.
16628007 2006 Post-translational regulation of circadian transcriptional CLOCK(NPAS2)/BMAL1 complex by CRYPTOCHROMES.
16528748 2006 Suggestive evidence for association of the circadian genes PERIOD3 and ARNTL with bipolar disorder.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645221 2004 Histone acetyltransferase-dependent chromatin remodeling and the vascular clock.
12655319 2003 Circadian clock-related polymorphisms in seasonal affective disorder and their relevance to diurnal preference.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441147 2001 NPAS2: an analog of clock operative in the mammalian forebrain.
11441146 2001 Regulation of clock and NPAS2 DNA binding by the redox state of NAD cofactors.
11439184 2001 Regulation of CLOCK and MOP4 by nuclear hormone receptors in the vasculature: a humoral mechanism to reset a peripheral clock.
10864874 2000 Impaired cued and contextual memory in NPAS2-deficient mice.
9576906 1998 The basic-helix-loop-helix-PAS orphan MOP3 forms transcriptionally active complexes with circadian and hypoxia factors.
9079689 1997 Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.
9012850 1997 Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.