Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.62
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-03
glioblastoma -1.200 3.3e-04
group 4 medulloblastoma -1.300 1.0e-03
medulloblastoma, large-cell -1.100 6.0e-04
posterior fossa group A ependymoma -1.100 1.1e-05
primary pancreatic ductal adenocarcinoma -1.092 1.4e-02
psoriasis -2.100 6.4e-64

Gene RIF (1)

AA Sequence

MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKSRNAARSRRGKENLEFFELAK      1 - 70
LLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLAPGRRGPAALVSEVFEQHLGG     71 - 140
HILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGSSVFDYIHPGDHSEVLEQLGLRTPTPGPPTP    141 - 210
PSVSSSSSSSSSLADTPEIEASLTKVPPSSLVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHA    211 - 280
LGLVALGHTLPPAPLAELPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRI    281 - 350
RQSHVDLLDKGQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQL    351 - 420
PASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGKRIKVEPGPRETKGSEDSGDEDPSSHPATP    421 - 490
RPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPTLLHAGFLPPVVRGLCTPGTIRYGPAELGLVYPHLQRLG    491 - 560
PGPALPEAFYPPLGLPYPGPAGTRLPRKGD                                            561 - 590
//

Text Mined References (7)

PMID Year Title