Property Summary

NCBI Gene PubMed Count 24
PubMed Score 16.12
PubTator Score 18.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.2e-05
glioblastoma -1.400 4.1e-06
medulloblastoma, large-cell -1.600 2.2e-05
pediatric high grade glioma -1.200 1.3e-05
non primary Sjogren syndrome sicca 1.300 2.0e-02
lung adenocarcinoma 1.300 1.5e-07

Gene RIF (12)

PMID Text
24187133 A NOXA1 peptide blocked NOXA1-Nox1 binding. The finding identifies a NOXA1-activating domain and an isoform-specific Nox1 inhibitor.
23957209 Phosphorylation of Thr341 allows Noxo1 to sufficiently interact with Noxa1, an interaction that participates in Nox1 activation
22244833 Noxa1 has quite different kinetic properties from p67(phox) and suggest that Noxa1 may function as a moderate activator of Nox2.
20943948 The Nox1-dependent generation of reactive oxygen species is dependent on Src phosphorylation of NoxA1 and Tks4. Blockage of phosphorylation of NoxA1 and Tks4 decreases Nox1-dependent ROS generation and blocks SrcYF-induced invadopodia formation.
20609497 Tks4 and Tks5 directly bind to NoxA1. The integrity of the N-terminal PRR of NoxA1 is essential for this direct interaction with the Tks proteins.
20454568 The first quantitative characterization of the interactions made between the cytosolic regulators NOXO1 and NOXA1 and membrane-bound p22(phox), is presented.
20230789 these results demonstrate that phosphorylation of NoxA1 is a part of the feedback mechanism that functions through activation of Rac with a net outcome of negative modulation of Nox1 activity.
20083677 NoxA1 is the functional homolog of p67phox in vascular smooth muscle cells (VSMC) that regulates redox signaling and VSMC phenotype.
18606821 a novel, inhibitory function for Noxa1 in Duox1 regulation.
18568954 Essential role of NOXA1 in generation of reacgtive oxygen species induced by oxidized low density lipoprotein in endothelial cells is reported.
17913709 PKA-phosphorylated NoxA1 is a new binding partner of 14-3-3 protein; this forms the basis of a novel mechanism regulating the formation of ROS by Nox1 and, potentially, other NoxA1-regulated Nox family members
17602954 These studies demonstrate that, in reconstituted NOX1/NOXO1/NOXA1 systems, the NOXA1 SH3 domain is not required for function but, when present, can critically modulate the activity of the enzyme system.

AA Sequence

MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRAFDQAVTKDTC      1 - 70
MAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTE     71 - 140
AASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAI    141 - 210
PDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAP    211 - 280
LSPGLPAMGGPGPGPCEDPAGAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQ    281 - 350
LGQLSYLAPGEDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGF    351 - 420
RQGDTVDVLCEVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP                  421 - 476
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24187133 2013 Selective recapitulation of conserved and nonconserved regions of putative NOXA1 protein activation domain confers isoform-specific inhibition of Nox1 oxidase and attenuation of endothelial cell migration.
23957209 2013 Phosphorylation of Noxo1 at threonine 341 regulates its interaction with Noxa1 and the superoxide-producing activity of Nox1.
22244833 2012 Noxa1 as a moderate activator of Nox2-based NADPH oxidase.
20943948 2010 c-Src-mediated phosphorylation of NoxA1 and Tks4 induces the reactive oxygen species (ROS)-dependent formation of functional invadopodia in human colon cancer cells.
20609497 Direct interaction between Tks proteins and the N-terminal proline-rich region (PRR) of NoxA1 mediates Nox1-dependent ROS generation.
20454568 2010 Regulation of NOXO1 activity through reversible interactions with p22 and NOXA1.
20230789 2010 Phosphorylation of serine282 in NADPH oxidase activator 1 by Erk desensitizes EGF-induced ROS generation.
20083677 2010 Nox activator 1: a potential target for modulation of vascular reactive oxygen species in atherosclerotic arteries.
19755710 2009 Novel p47(phox)-related organizers regulate localized NADPH oxidase 1 (Nox1) activity.
18606821 2008 Inhibitory action of NoxA1 on dual oxidase activity in airway cells.
18568954 Essential role of NOXA1 in generation of reactive oxygen species induced by oxidized low-density lipoprotein in human vascular endothelial cells.
17913709 2007 Regulation of Nox1 activity via protein kinase A-mediated phosphorylation of NoxA1 and 14-3-3 binding.
17602954 2007 NOX1 NADPH oxidase regulation by the NOXA1 SH3 domain.
17189823 2007 The 'A's and 'O's of NADPH oxidase regulation: a commentary on "Subcellular localization and function of alternatively spliced Noxo1 isoforms".
17126813 2007 Interaction between the SH3 domains and C-terminal proline-rich region in NADPH oxidase organizer 1 (Noxo1).
16762923 2006 Direct involvement of the small GTPase Rac in activation of the superoxide-producing NADPH oxidase Nox1.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16636067 2006 Nox1-dependent reactive oxygen generation is regulated by Rac1.
16507994 2006 Involvement of Rac1 in activation of multicomponent Nox1- and Nox3-based NADPH oxidases.
15824103 2005 The NADPH oxidase Nox3 constitutively produces superoxide in a p22phox-dependent manner: its regulation by oxidase organizers and activators.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15181005 2004 Nox3 regulation by NOXO1, p47phox, and p67phox.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14978110 2004 Role of nicotinamide adenine dinucleotide phosphate oxidase 1 in oxidative burst response to Toll-like receptor 5 signaling in large intestinal epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14617635 2004 NOXO1, regulation of lipid binding, localization, and activation of Nox1 by the Phox homology (PX) domain.
12716910 2003 Novel human homologues of p47phox and p67phox participate in activation of superoxide-producing NADPH oxidases.
12657628 2003 Proteins homologous to p47phox and p67phox support superoxide production by NAD(P)H oxidase 1 in colon epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473664 2003 Two novel proteins activate superoxide generation by the NADPH oxidase NOX1.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.