Property Summary

NCBI Gene PubMed Count 59
PubMed Score 71.40
PubTator Score 80.82

Knowledge Summary

Patent (2,624)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 3.7e-05
Disease Target Count Z-score Confidence
Gastroesophageal reflux disease 37 3.215 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.180 3.7e-05

Gene RIF (52)

PMID Text
26901778 Rho Kinase ROCK2 Mediates Acid-Induced NADPH Oxidase NOX5-S Expression in Human Esophageal Adenocarcinoma Cells
26510438 REVIEW: recent knowledge of the genetic and enzymatic regulation of NOX5 and the importance of NOX5 in human physiology and pathophysiology.
26109726 These results provide new insight into the redox-dependent mechanism of HTLV-1 transformation and raises an intriguing possibility that Nox5alpha serves as a potential molecular target to treat HTLV-1-related leukemia.
25871798 Induction of Nox5 expression in IFNgamma- and oxidized LDL-exposed Mac and the presence of Nox5 in Mac-rich atheroma are indicative of the implication of Nox5 in atherogenesis.
25797883 NOX5-derived reactive oxygen species contribute to apoptosis blockage in ALK-positive anaplastic large-cell lymphoma cell lines.
25722086 High glucose generated an increase in NADPH oxidase activity and expression in human vascular smooth muscle cells. Sequence analysis of human Nox1, Nox4, and Nox5 gene promoters
25706776 we show here for the first time that two members of the ROS-generating NADPH oxidase family (NOXs), NOX4 and NOX5, are involved in radiation-induced DNA damage.
25559363 Nox5-derived ROS and subsequent depletion of PKCzeta and JNK inactivation play a critical role in modulating intracellular signaling cascades involved in the proliferation and survival of PCa cells.
25415612 Initial findings suggest that glomerular and tubular expression of Nox5 is induced during diabetes and hypertension, respectively. Furthermore, identification of SNPs in distinct human populations suggests a role for either good or ill for this enzyme.
24688893 Results show that NOX5 is expressed in human renal proximal tubule cells and to greater extent than the other NOX isoforms in hypertensive than normotensive subjects.
24505490 The study reveals that PKC-alpha is the primary isoform mediating the activation of Nox5.
24262797 podocyte Nox5 has an important role in impaired renal function and hypertension.
23851018 Tissue microarray analysis revealed, for the first time, substantial Nox5 overexpression in several human cancers
23439561 Overexpression of NOX5-S significantly increased the luciferase activity.
23030296 this study demonstrates the presence of NOX5 in acrosomal, equatorial, post-acrosomal regions, the body and the tail of ejaculated human teratozoospermia.
22503554 we demonstrate NOX5 expression in human intramyocardial blood vessels and cardiomyocytes, with significant increases in the affected myocardium after acute myocardial infarction.
22427510 Nox5-alpha and -beta splice variants are the major isoforms that are expressed blood vessels and the only variants capable of ROS production.
22387196 results suggest that endogenously produced NO can directly S-nitrosylate and inhibit the activity of Nox5
22291013 Inhibition of NOX5 activity reduces spermatozoa motility.
22182486 There has been a rapid increase in our understanding of the NOX5 gene, the structural and biochemical aspects of the NOX5 enzyme, the role NOX5 plays in health and disease, and the development of novel NOX inhibitors. [Review]
21901141 Reduced matrigel invasion was mediated by reduced ROS levels coinciding with decreased expression of NADPH oxidase 2, 3, 4 and 5 involved in ROS production.
21525435 Rac1 may be important in activation of NOX5-S in Barrett's esphageal adenocarcinoma cells.
21483469 PDGF-BB inhibits NADPH oxidase-mediated reactive oxygen species production induced by HIV-1 Tat and morphine treatment in neuroblastoma cells
21319793 Nox5 forms a catalytically active oligomer in the membrane that is mediated by its dehydrogenase domain
21297032 The current work is the first to demonstrate that MAPK signaling can directly influence the phosphorylation state of transmembrane NOX5 enzyme, contributing to NOX5's activation in response to phorbol 12-myristate acetate and at resting calcium levels.
20576920 The effect of pH on the expression of p16 and NOX5-S on Barrett's esophagus cells and their progression to esophageal adenocarcinoma are reported.
20339118 Endothelial cells possess functionally active Nox5 that is regulated at the transcriptional/translational levels by Ang II and ET-1 through calcium/calmodulin-sensitive processes.
20230798 Shingosylphosphorylcholine down-regulates FLG gene transcription through NOX5-based NADPH oxidase and COX-2 in human keratinocytes.
20086178 Data show that bile acid reflux present in patients with BE may increase reactive oxygen species production and cell proliferation via activation of PI-PLCgamma2, ERK2 MAP kinase, and NADPH oxidase NOX5-S, thereby contributing to the development of EA.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18672905 In vitro NADPH oxidase activity assay reveals that this glycine mutant of the full-length protein greatly reduced NADPH oxidase activity upon activation even though it displayed PI(3,4)P2 binding activity comparable to that of the isolated PX domain.
18614798 extracellular ROS production by Nox5 is modulated by PtdIns(4,5)P(2) by localizing Nox5 to the plasma membrane
18468509 NADPH oxidase activation is required for rhLIGHT-induced migration in human monocytes.
18466778 ROS produced by Nox5 play an important role in platelet-derived growth factor-induced JAK/STAT activation and human aortic smooth muscle cell proliferation
17947454 Acid-induced NOX5-S expression is mediated by platelet activating factor and STAT5 in esophageal adenocarcinoma cells.
17603936 Inhibition of NADPH oxidase by apocynin may represent an attractive therapeutic approach to treat heart failure.
17587483 Results demonstrate that NOX5 can be found intracellularly and at the cell surface.
17346712 calmodulin binds to the NOX5 C terminus consensus calmodulin-binding domain in a Ca(2+)-dependent manner, changes its conformation and increases the Ca(2+) sensitivity of the N terminus-regulated enzymatic activity.
17214994 NAD(P)H oxidase polymorphism (C242T) associates with recurrent coronary events in postinfarction patients
17164239 phosphorylation of Nox5 at key residues facilitates enzyme activation at lower levels of intracellular calcium and may provide an avenue for enzyme activation in response to a greater variety of extracellular stimuli
17122966 NADPH oxidase is involved in the superoxide release by RA synovial cells, constitutively and after cytokine up-regulation.
17089090 Chronic granulomatous disease (CGD) is a rare primary immunodeficiency caused by mutations of one of the subunits of phagocyte reduced nicotinamide adenine dinucleotide phosphate (NADPH) oxidase leading to decreased of neutrophil oxidative burst.
16873416 NO-mediated down-regulation by shear stress preferentially affects the gp91(phox)/p47(phox)-containing NAD(P)H oxidase complex.
16707484 Knockdown of NOX5 also significantly decreased retinoblastoma protein phosphorylation and increased cell apoptosis and caspase-9 expression.
16339585 Hairy cells(but not circulating normal B cells or some other lymphoid cell types) express NOX5; the inactivation of SHP-1 by NOX5-generated ROS contributes to the maintenance of the constitutive activation of HCs.
16177112 Appreciable bacterial phospholipid degradation occurs only in the presence of catalytically active group IIA-phospholipase A2 and a functional respiratory burst NADPH oxidase in neutrophils.
15509740 PDGF-BB inhibits NADPH oxidase-mediated reactive oxygen species production induced by HIV-1 Tat and morphine treatment in neuroblastoma cells
14982937 the regulatory N terminus and the catalytic C terminus of NOX5 interact in a Ca(2+)-dependent way; enzyme activation occurs through an intra-molecular interaction
12186557 we propose that the GTP-bound active form of Rac is required for sustained enzyme activity and that membrane-localized GAPs have a role in the deactivation of NADPH oxidase
12121572 Reactive oxygen species producing activity of NOX5 in sperm and NADPH-oxidase of white blood cells; role of protein kinase C in NOX5 activation
11483596 NOX5 is likely to be involved in Ca(2+)-activated, redox-dependent processes of spermatozoa and lymphocytes such as sperm-oocyte fusion, cell proliferation, and cytokine secretion.
9882350 PDGF-BB inhibits NADPH oxidase-mediated reactive oxygen species production induced by HIV-1 Tat and morphine treatment in neuroblastoma cells

AA Sequence

MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESFFAERFFALFD      1 - 70
SDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTEWGAGAGPHWASSPLGTGSGS     71 - 140
IDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADADGNGAITFEELRDELQRFPGVMENLTISAAH    141 - 210
WLTAPAPRPRPRRPRQLTRAYWHNHRSQLFCLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFD    211 - 280
CSFIAVLMLRRCLTWLRATWLAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFW    281 - 350
ELLLTTRPGIGWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFW    351 - 420
KWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLNIPTIARYEWH    421 - 490
PFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVTMRKSQRSSKGSEILLEKHKF    491 - 560
CNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASILQSIMYRHQKRKHTCPSCQHSWIEGVQDNMK    561 - 630
LHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANK    631 - 700
EKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF         701 - 765
//

Text Mined References (62)

PMID Year Title
26901778 2016 Rho Kinase ROCK2 Mediates Acid-Induced NADPH Oxidase NOX5-S Expression in Human Esophageal Adenocarcinoma Cells.
26510438 2015 Enzymatic regulation and functional relevance of NOX5.
26109726 2015 Superoxide-Generating Nox5? Is Functionally Required for the Human T-Cell Leukemia Virus Type 1-Induced Cell Transformation Phenotype.
25871798 2015 Human monocytes and macrophages express NADPH oxidase 5; a potential source of reactive oxygen species in atherosclerosis.
25797883 2015 The NADPH oxidase NOX5 protects against apoptosis in ALK-positive anaplastic large-cell lymphoma cell lines.
25722086 2015 High-glucose-increased expression and activation of NADPH oxidase in human vascular smooth muscle cells is mediated by 4-hydroxynonenal-activated PPAR? and PPAR?/?.
25706776 2015 Inactivation of NADPH oxidases NOX4 and NOX5 protects human primary fibroblasts from ionizing radiation-induced DNA damage.
25559363 2016 ROS signaling by NADPH oxidase 5 modulates the proliferation and survival of prostate carcinoma cells.
25415612 2015 NADPH oxidase 5 and renal disease.
24688893 2014 Unique role of NADPH oxidase 5 in oxidative stress in human renal proximal tubule cells.
24505490 2014 Regulation of NADPH oxidase 5 by protein kinase C isoforms.
24262797 2014 Nephropathy and elevated BP in mice with podocyte-specific NADPH oxidase 5 expression.
23851018 2013 Characterization of NADPH oxidase 5 expression in human tumors and tumor cell lines with a novel mouse monoclonal antibody.
23439561 2013 NADPH oxidase NOX5-S and nuclear factor ?B1 mediate acid-induced microsomal prostaglandin E synthase-1 expression in Barrett's esophageal adenocarcinoma cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
23030296 2013 Expression of NOX5 in human teratozoospermia compared to normozoospermia.
22503554 2012 NOX5 expression is increased in intramyocardial blood vessels and cardiomyocytes after acute myocardial infarction in humans.
22427510 2012 Expression and functional significance of NADPH oxidase 5 (Nox5) and its splice variants in human blood vessels.
22387196 2012 Nitric oxide reduces NADPH oxidase 5 (Nox5) activity by reversible S-nitrosylation.
22291013 2012 NOX5 in human spermatozoa: expression, function, and regulation.
22182486 2012 NOX5: from basic biology to signaling and disease.
21901141 2011 Impaired OXPHOS complex III in breast cancer.
21525435 2011 Role of Rac1 in regulation of NOX5-S function in Barrett's esophageal adenocarcinoma cells.
21319793 2011 Nox5 forms a functional oligomer mediated by self-association of its dehydrogenase domain.
21297032 2011 Molecular regulation of NADPH oxidase 5 via the MAPK pathway.
20576920 2010 Acid-induced p16 hypermethylation contributes to development of esophageal adenocarcinoma via activation of NADPH oxidase NOX5-S.
20339118 2010 Nicotinamide adenine dinucleotide phosphate reduced oxidase 5 (Nox5) regulation by angiotensin II and endothelin-1 is mediated via calcium/calmodulin-dependent, rac-1-independent pathways in human endothelial cells.
20230798 2010 Sphingosylphosphorylcholine down-regulates filaggrin gene transcription through NOX5-based NADPH oxidase and cyclooxygenase-2 in human keratinocytes.
20086178 2010 Bile acid reflux contributes to development of esophageal adenocarcinoma via activation of phosphatidylinositol-specific phospholipase Cgamma2 and NADPH oxidase NOX5-S.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
18672905 2008 Mutations in the PX-SH3A linker of p47phox decouple PI(3,4)P2 binding from NADPH oxidase activation.
18614798 2008 Phosphatidylinositol (4,5)-bisphosphate modulates Nox5 localization via an N-terminal polybasic region.
18468509 2008 NADPH oxidase activation is required for migration by LIGHT in human monocytes.
18466778 2008 Nox5 mediates PDGF-induced proliferation in human aortic smooth muscle cells.
17947454 2008 STAT5 mediates PAF-induced NADPH oxidase NOX5-S expression in Barrett's esophageal adenocarcinoma cells.
17603936 2007 Inhibition of NADPH oxidase reduces myocardial oxidative stress and apoptosis and improves cardiac function in heart failure after myocardial infarction.
17587483 2007 NOX5 is expressed at the plasma membrane and generates superoxide in response to protein kinase C activation.
17346712 2007 NADPH oxidase 5 (NOX5) interacts with and is regulated by calmodulin.
17275676 2007 NOX5 variants are functionally active in endothelial cells.
17214994 2008 NAD(P)H oxidase polymorphism (C242T) and high HDL cholesterol associate with recurrent coronary events in postinfarction patients.
17164239 2007 Novel mechanism of activation of NADPH oxidase 5. calcium sensitization via phosphorylation.
17122966 2006 Superoxide production and NADPH oxidase expression in human rheumatoid synovial cells: regulation by interleukin-1beta and tumour necrosis factor-alpha.
17089090 2007 Severe X-linked chronic granulomatous disease in two unrelated females.
16873416 2006 NO-mediated regulation of NAD(P)H oxidase by laminar shear stress in human endothelial cells.
16707484 2006 cAMP-response element-binding protein mediates acid-induced NADPH oxidase NOX5-S expression in Barrett esophageal adenocarcinoma cells.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339585 2005 Expression and activity of NOX5 in the circulating malignant B cells of hairy cell leukemia.
16179589 2005 NAD(P)H oxidase 4 mediates transforming growth factor-beta1-induced differentiation of cardiac fibroblasts into myofibroblasts.
16177112 2005 Synergy between extracellular group IIA phospholipase A2 and phagocyte NADPH oxidase in digestion of phospholipids of Staphylococcus aureus ingested by human neutrophils.
15994299 2005 Point mutations in the proline-rich region of p22phox are dominant inhibitors of Nox1- and Nox2-dependent reactive oxygen generation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14982937 2004 Mechanism of Ca2+ activation of the NADPH oxidase 5 (NOX5).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12686516 2003 NOX5 NAD(P)H oxidase regulates growth and apoptosis in DU 145 prostate cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12186557 2002 Participation of Rac GTPase activating proteins in the deactivation of the phagocytic NADPH oxidase.
12121572 2002 A comparison of the NADPH oxidase in human sperm and white blood cells.
11483596 2001 A Ca(2+)-activated NADPH oxidase in testis, spleen, and lymph nodes.
11376945 2001 Homologs of gp91phox: cloning and tissue expression of Nox3, Nox4, and Nox5.