Property Summary

Ligand Count 3
NCBI Gene PubMed Count 65
PubMed Score 76.82
PubTator Score 80.82

Knowledge Summary

Patent (2,624)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Gastroesophageal reflux disease 110 3.161 1.6
Hypertension 396 3.019 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.180 3.7e-05

Gene RIF (58)

AA Sequence

MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESFFAERFFALFD      1 - 70
SDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTEWGAGAGPHWASSPLGTGSGS     71 - 140
IDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADADGNGAITFEELRDELQRFPGVMENLTISAAH    141 - 210
WLTAPAPRPRPRRPRQLTRAYWHNHRSQLFCLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFD    211 - 280
CSFIAVLMLRRCLTWLRATWLAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFW    281 - 350
ELLLTTRPGIGWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFW    351 - 420
KWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLNIPTIARYEWH    421 - 490
PFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVTMRKSQRSSKGSEILLEKHKF    491 - 560
CNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASILQSIMYRHQKRKHTCPSCQHSWIEGVQDNMK    561 - 630
LHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANK    631 - 700
EKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF         701 - 765
//

Text Mined References (68)

PMID Year Title