Property Summary

NCBI Gene PubMed Count 25
PubMed Score 45.95
PubTator Score 38.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.500 5.7e-06
astrocytic glioma 1.100 2.3e-02
psoriasis -1.300 4.9e-06
oligodendroglioma 1.200 1.5e-09
glioblastoma 1.700 7.8e-03
cystic fibrosis 2.940 2.1e-07
medulloblastoma, large-cell -1.500 1.3e-04
Atopic dermatitis -1.300 1.9e-03
colon cancer -2.300 1.4e-02
lung cancer 1.900 2.4e-02
breast carcinoma -1.100 5.1e-05
Breast cancer -2.400 2.5e-02
pediatric high grade glioma 1.800 4.8e-04
group 3 medulloblastoma -1.100 6.8e-03
pilocytic astrocytoma 1.700 5.4e-08
non primary Sjogren syndrome sicca -1.100 2.6e-02
subependymal giant cell astrocytoma -1.811 1.7e-02
invasive ductal carcinoma -2.800 9.7e-03
lung carcinoma 3.100 1.3e-42
ductal carcinoma in situ -2.400 5.9e-04

Gene RIF (9)

PMID Text
26391641 Data indicate RNA binding protein NOVA1 as a target of microRNA miR-339.
26108672 Quantitative proteomic analysis was performed to help elucidate a molecular distinction between glioblastoma and oligodendroglioma; analysis showed HSPB1 and NOVA1 to be discriminating factors.
25299073 MiR-181b-5p is a tumor suppressor in astrocytoma that inhibits tumor progression by targeting NOVA1.
24608171 High expression of NOVA1 correlates with poor prognosis in hepatocellular carcinoma.
24312278 a regulation of LEDGF interaction with chromatin by cellular partners of its PWWP domain could be involved in several processes linked to LEDGF tethering properties, such as lentiviral integration, DNA repair or transcriptional regulation
19680635 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18822086 Semiquantitative estimation of circulating anti-Ri antibodies demonstrated a renewed increase in antibody levels preceding relapse of the cancer, as confirmed using F-fluorodeoxyglucose positron emission tomography (FDG-PET)
18218628 Gene silencing and overexpression of the nELAV member HuD in motoneuronal NSC34 cells indicate that Nova1 mRNA stability and translation are positively and strongly controlled by the nELAV proteins

AA Sequence

MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ      1 - 70
TIVQLQKETGATIKLSKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQ     71 - 140
PQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQL    141 - 210
SQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAE    211 - 280
VLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAA    281 - 350
AAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKST    351 - 420
DGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYL    421 - 490
ITQRITYEQGVRAANPQKVG                                                      491 - 510
//

Text Mined References (29)

PMID Year Title
26391641 2015 MicroRNA-339, an epigenetic modulating target is involved in human gastric carcinogenesis through targeting NOVA1.
26108672 2015 Quantitative proteomic analysis shows differentially expressed HSPB1 in glioblastoma as a discriminating short from long survival factor and NOVA1 as a differentiation factor between low-grade astrocytoma and oligodendroglioma.
25407941 2014 GWAS identifies four novel eosinophilic esophagitis loci.
25299073 2014 MiR-181b-5p downregulates NOVA1 to suppress proliferation, migration and invasion and promote apoptosis in astrocytoma.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24608171 2014 High expression of neuro-oncological ventral antigen 1 correlates with poor prognosis in hepatocellular carcinoma.
24312278 2013 TOX4 and NOVA1 proteins are partners of the LEDGF PWWP domain and affect HIV-1 replication.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19680635 2009 Genome-wide association study of antipsychotic-induced parkinsonism severity among schizophrenia patients.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18822086 2009 Paraneoplastic antibody during follow-up of a patient with anti-Ri-associated paraneoplastic neurological syndrome.
18218628 2008 Post-transcriptional regulation of neuro-oncological ventral antigen 1 by the neuronal RNA-binding proteins ELAV.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16041372 2005 Nova regulates brain-specific splicing to shape the synapse.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12808107 2003 Nova regulates GABA(A) receptor gamma2 alternative splicing via a distal downstream UCAU-rich intronic splicing enhancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10719891 2000 Nova-1 regulates neuron-specific alternative splicing and is essential for neuronal viability.
10368286 1999 Crystal structures of Nova-1 and Nova-2 K-homology RNA-binding domains.
9154818 1997 The neuronal RNA binding protein Nova-1 recognizes specific RNA targets in vitro and in vivo.
8558240 1996 The onconeural antigen Nova-1 is a neuron-specific RNA-binding protein, the activity of which is inhibited by paraneoplastic antibodies.
8398153 1993 Nova, the paraneoplastic Ri antigen, is homologous to an RNA-binding protein and is specifically expressed in the developing motor system.