Property Summary

NCBI Gene PubMed Count 80
PubMed Score 152.63
PubTator Score 386.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 2.100 9.1e-08
astrocytic glioma -1.900 4.1e-02
oligodendroglioma -2.300 3.6e-03
psoriasis -1.100 8.9e-05
cutaneous lupus erythematosus -1.600 1.1e-03
glioblastoma -1.400 3.1e-02
osteosarcoma 1.910 4.7e-02
medulloblastoma -2.200 6.6e-04
medulloblastoma, large-cell -3.000 1.3e-03
primitive neuroectodermal tumor -1.900 9.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.428 2.1e-02
adrenocortical carcinoma -2.595 6.6e-03
intraductal papillary-mucinous adenoma (... -2.700 1.8e-04
intraductal papillary-mucinous carcinoma... -2.100 1.7e-02
interstitial cystitis 2.100 3.4e-05
adult high grade glioma -1.100 4.9e-02
pilocytic astrocytoma -1.300 8.9e-03
posterior fossa group B ependymoma -1.100 1.2e-02
Breast cancer -2.800 5.6e-14
nasopharyngeal carcinoma 1.700 1.3e-03
Endometriosis -1.593 2.1e-02
invasive ductal carcinoma -1.600 2.7e-02
ovarian cancer 1.400 4.4e-03
pituitary cancer -3.000 2.0e-06

 GWAS Trait (1)

Pathway (1)

Protein-protein Interaction (2)

Gene RIF (61)

PMID Text
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26367310 NOV expression was highly increased in biopsies of patients with tubulointerstitial nephritis.
26238193 Results revealed that NOV regulates the tumor growth of osteosarcoma cells through activation of the MAPK signaling pathway and promotes osteosarcoma cell migration in vitro.
25899830 our results argue that MZF-1 regulates the CTGF and NOV genes in the hematopoietic compartment, and may be involved in their respective functions in the stroma.
24721786 Overexpression of CCN3 induces M2 macrophage infiltration and contributes to angiogenesis in prostate cancer microenvironment.
24719190 NOV may promote carcinogenesis via promotion of EMT and association with increased mTOR activity
24431313 CCN3 may play an important role in cervical carcinogenesis and therefore may have potential as a biomarker for prognosis and as a therapeutic target in cervical cancer.
24406215 CCN3 can promote dentinogenesis by coordinating proliferation and odontoblastic differentiation of dental pulp stem cells via modulating Notch and BMP2 signaling pathways.
24308033 Demonstrated oncogenic role for NOTCH1 in Chronic Myelogenous Leukemia (CML) and BCR-ABL disruption of NOTCH1-CCN3 signalling may contribute to the pathogenesis of CML.
24258112 over-expression of NOV in pancreatic cancer cells promoted cell proliferation and migration, while knock down the expression of NOV impaired the tumorigenecity of pancreatic cancer cells in vitro and in vivo
23785511 in obese humans and mice plasma NOV levels positively correlated with NOV expression in adipose tissue, and support a possible contribution of NOV to obesity-related inflammation.
23705021 These results identify CCN3, a novel transcriptional target of FoxO1 in pancreatic beta-cells.
23536580 CCN3 expression is higher in highly invasive PC3 cells.
23318417 Our findings establish a tumor-suppressive role of NOV in prostate cancer
23220688 Presence of both forms of CCN3 is accompanied by a balance of trophoblast proliferation and migration/invasion properties, which are triggered by different signalling pathways.
23061738 Data suggest that urinary CCN3/CCN2 mRNA ratio may be a useful noninvasive biomarker for evaluating patients with nondiabetic chronic kidney disease (CKD) prior to renal biopsy.
22507556 Melanocytes remaining in perilesional vitiligo skin did not express CCN3.
22345292 results indicate that CCN3 enhances the migration of prostate cancer cells by increasing ICAM-1 expression through a signal transduction pathway that involves alphavbeta3 integrin, ILK, Akt and NF-kappaB
21898398 Provide evidence that CCN3 enhances BMP-4 expression and bone nodule formation in osteoblasts, and that the integrin receptor, ILK, p38, JNK, and AP-1 signaling pathways may be involved.
21784733 CCN3 protein regulates the decrease in Jeg3 cell numbers independent of its glycosylation status
21514448 CCN3 regulates the differentiation of bone resident cells to create a resorptive environment that promotes the formation of osteolytic breast cancer metastases
21423212 Data show reduced CCN3 levels in aRMS cells following small interfering RNA knockdown of PAX3-FKHR.
21344378 CCN3 enhances the migration of chondrosarcoma cells by increasing MMP-13 expression through the alphavbeta3/alphavbeta5 integrin receptor, FAK, PI3K, Akt, p65, and NF-kappaB signal transduction pathway.
21209863 Recombinant expression, purification, and functional characterisation of connective tissue growth factor and nephroblastoma-overexpressed protein
21145881 NOV acts through alphavbeta5 integrin to activate ILK and Akt, which in turn activates c-Jun and AP-1, resulting in the activations of COX-2 and contributing the migration of human osteosarcoma cells.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20336664 Only defined binding properties between Cx43 and CCN3 leading to an upregulation of CCN3 are needed for signaling.
20237132 CYR61 and NOV are regulated by HIF-1alpha and TGF-beta3 in the trophoblast cell line JEG3, and their enhanced secretion could be implicated in appropriate placental invasion.
20182440 CCN3 counter-regulates positive signals from TGF-beta and Wnt for fibrillin fibrillogenesis and profibrotic gene expression.
20139355 CCN3 suppresses neointimal thickening through the inhibition of vascular smooth cell migration and proliferation.
20010302 The angiogenic gene CCN3/nov was specifically downregulated in the plexiform neurofibromas and malignant peripheral nerve sheath tumor.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19706598 CCN3 increases the activity of the small GTPase Rac1, thereby revealing a pathway that links Cx43 directly to actin reorganization.
19695675 expression of the full-length CCN3 in Ewing sarcoma is associated with a worse prognosis
19286457 These findings identify a new paracrine role of NOV in the development of cerebellar granule neurons.
18984771 TACC1 and a three-gene expression signature (TACC1, NOV, and PTTG1) were identified as independent prognostic markers.
18418052 Thus, elevated levels of CCN3 protein regulated by p53 might influence cell adhesion
18245529 CCN3, but not CCN1 or CCN2, may be a prognosis factor for human osteosarcomas
18245471 CCN3 may play a role in the progression and metastatic potential of melanomas
18089610 Reduction of CCN1/CCN3 in preeclampsia could be responsible for the failure of uterine vascular remodeling.
18066593 Our data suggest expression of a truncated nuclear CCN3 variant lacking the thrombospondin type-1-like domain and cytoplasmic full-length CCN3 protein in Wilms' tumor cells.
17968313 the lack of CCN3 in advanced melanoma cells contributes to their invasive phenotype.
17968313 results suggest that the lack of CCN3 in advanced melanoma cells contributes to their invasive phenotype
17566092 reduced expression of NOV in childhood adrenocortical tumors may play an important role in the process of childhood childhood adrenocortical tumors tumorigenesis
17463287 Nov is identified as being essential for the functional integrity of hematopoietic stem and progenitor cells
17340618 Data suggest that the production of CCN3 varies throughout the cell cycle, and that CCN3-induced inhibition of cell growth can be partially reversed by specific antibodies raised against a C-terminal peptide of CCN3.
17163153 CCN protein also interact with several other receptors and ligands that play critical roles in the regulation of cell signaling and communication
17101694 DDR1 knockdown decreased melanocyte adhesion to collagen IV and shifted melanocyte localization in a manner similar to CCN3 knockdown.
16675545 In early-onset pre-eclamptic placentae, NOV was expressed at a significantly lower level compared with normal matched controls, indicating a potential role of this molecule in the pathogenesis of early-onset pre-eclampsia.
16670264 Transfecting CCN3 into BCR-ABL+ cells inhibited proliferation and decreased clonogenic potential in acute myeloid leukemia.
16600215 Results suggest that NOV (nephroblastoma overexpressed) is a specific cell fate regulator in the myogenic lineage, acting negatively on key myogenic genes thus controlling the transition from progenitor cells to myoblasts.
16145471 Data indicates that NOV is associated with carcinogenesis and the progression of renal cell carcinoma, and the NOV expression level is different in papillary-type and clear cell-type RCC.
15824736 expression of CCN3 in Ewing's sarcoma primary tumors may be associated with a higher risk of developing lung and/or bone metastases
15611078 CCN3 has a role in cutaneous wound healing in skin fibroblasts
15181016 Cx43 is able to regulate cell growth via an up-regulation of NOV transcription
15053922 evidence that adenylate cyclase as well as one or several protein kinases might be involved in the mechanoregulation of Cyr61, CTGF and Nov genes
14519668 NOVH increases cell adhesion and migration of glioblastoma cells via matrix metalloprotease 3 expression and a PDGFR-alpha dependent mechanism.
12695522 in endothelial cells, CCN3 supports cell adhesion, induces directed cell migration (chemotaxis), and promotes cell survival
12519873 NOVH concentration was significantly modified in malignant but not benign adrenocortical tumors; the concentration of NOVH was significantly decreased in patients suffering from astrocytomas or multiple sclerosis
12050162 association with Notch1 extracellular domain and inhibition of myoblast differentiation via Notch signaling pathway
11891184 expression of this protein appears to be associated with a higher risk of developing metastases in Ewing's sarcoma

AA Sequence

MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQ      1 - 70
RGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC     71 - 140
VPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQT    141 - 210
TEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN    211 - 280
CTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELEL    281 - 350
KTTRGKM                                                                   351 - 357
//

Text Mined References (83)

PMID Year Title
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26367310 2015 Reduced NOV/CCN3 Expression Limits Inflammation and Interstitial Renal Fibrosis after Obstructive Nephropathy in Mice.
26238193 2015 NOV inhibits proliferation while promoting apoptosis and migration in osteosarcoma cell lines through p38/MAPK and JNK/MAPK pathways.
25899830 2015 Myeloid Zinc Finger 1 (MZF-1) Regulates Expression of the CCN2/CTGF and CCN3/NOV Genes in the Hematopoietic Compartment.
24722330 2014 Overexpression of CCN3 inhibits inflammation and progression of atherosclerosis in apolipoprotein E-deficient mice.
24721786 2014 Prostate cancer-derived CCN3 induces M2 macrophage infiltration and contributes to angiogenesis in prostate cancer microenvironment.
24719190 2014 NOV is upregulated and promotes migration and invasion in bladder cancer.
24431313 The clinical and prognostic significance of CCN3 expression in patients with cervical cancer.
24406215 2014 Promotion of dentin regeneration via CCN3 modulation on Notch and BMP signaling pathways.
24308033 2013 The matricellular protein CCN3 regulates NOTCH1 signalling in chronic myeloid leukaemia.
24258112 2014 NOV promoted the growth and migration of pancreatic cancer cells.
23785511 2013 Plasma NOV/CCN3 levels are closely associated with obesity in patients with metabolic disorders.
23705021 2013 Nov/Ccn3, a novel transcriptional target of FoxO1, impairs pancreatic ?-cell function.
23536580 2013 CCN3 promotes prostate cancer bone metastasis by modulating the tumor-bone microenvironment through RANKL-dependent pathway.
23318417 2014 CCN3/NOV gene expression in human prostate cancer is directly suppressed by the androgen receptor.
23220688 2013 CCN3 regulates proliferation and migration properties in Jeg3 trophoblast cells via ERK1/2, Akt and Notch signalling.
23061738 2012 Urinary mRNA expression of CCN2/CCN3 as a noninvasive marker for monitoring glomerular structure changes in nondiabetic chronic kidney disease.
22507556 2012 Study of CCN3 (NOV) and DDR1 in normal melanocytes and vitiligo skin.
22345292 2012 CCN3 increases cell motility and ICAM-1 expression in prostate cancer cells.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21898398 2012 CCN3 increases BMP-4 expression and bone mineralization in osteoblasts.
21871891 2011 Novel effects of CCN3 that may direct the differentiation of chondrocytes.
21784733 2011 Impact of CCN3 (NOV) glycosylation on migration/invasion properties and cell growth of the choriocarcinoma cell line Jeg3.
21626137 2011 Two-marker association tests yield new disease associations for coronary artery disease and hypertension.
21514448 2011 CCN3 impairs osteoblast and stimulates osteoclast differentiation to favor breast cancer metastasis to bone.
21423212 2011 Nephroblastoma overexpressed (NOV/CCN3) gene: a paired-domain-specific PAX3-FKHR transcription target that promotes survival and motility in alveolar rhabdomyosarcoma cells.
21344378 2011 CCN3 increases cell motility and MMP-13 expression in human chondrosarcoma through integrin-dependent pathway.
21209863 2010 Recombinant expression, purification, and functional characterisation of connective tissue growth factor and nephroblastoma-overexpressed protein.
21145881 2011 Nephroblastoma overexpressed gene (NOV) enhances cell motility and COX-2 upregulation of human osteosarcoma involves ?v?5 integrin, ILK and AP-1-dependent pathways.
21063504 2010 A novel role of CCN3 in regulating endothelial inflammation.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20336664 2010 More insights into the CCN3/Connexin43 interaction complex and its role for signaling.
20237132 2010 Regulation of the matricellular proteins CYR61 (CCN1) and NOV (CCN3) by hypoxia-inducible factor-1{alpha} and transforming-growth factor-{beta}3 in the human trophoblast.
20182440 2010 Antagonistic effect of the matricellular signaling protein CCN3 on TGF-beta- and Wnt-mediated fibrillinogenesis in systemic sclerosis and Marfan syndrome.
20139355 2010 CCN3 inhibits neointimal hyperplasia through modulation of smooth muscle cell growth and migration.
20010302 2010 Differential expression of CCN1/CYR61, CCN3/NOV, CCN4/WISP1, and CCN5/WISP2 in neurofibromatosis type 1 tumorigenesis.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19706598 2009 Matricellular protein CCN3 (NOV) regulates actin cytoskeleton reorganization.
19695675 2009 Prognostic relevance of CCN3 in Ewing sarcoma.
19286457 2010 NOV/CCN3 promotes maturation of cerebellar granule neuron precursors.
18984771 2009 Identification of TACC1, NOV, and PTTG1 as new candidate genes associated with endocrine therapy resistance in breast cancer.
18418052 2008 The CCN3 gene coding for an extracellular adhesion-related protein is transcriptionally activated by the p53 tumor suppressor.
18245529 2008 Prognostic value of CCN3 in osteosarcoma.
18245471 2008 CCN3/nephroblastoma overexpressed matricellular protein regulates integrin expression, adhesion, and dissemination in melanoma.
18089610 2007 The circulating proangiogenic factors CYR61 (CCN1) and NOV (CCN3) are significantly decreased in placentae and sera of preeclamptic patients.
18066593 2008 Expression of CCN3 protein in human Wilms' tumors: immunohistochemical detection of CCN3 variants using domain-specific antibodies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17968313 2008 Downregulation of CCN3 expression as a potential mechanism for melanoma progression.
17566092 2007 Nephroblastoma overexpressed/cysteine-rich protein 61/connective tissue growth factor/nephroblastoma overexpressed gene-3 (NOV/CCN3), a selective adrenocortical cell proapoptotic factor, is down-regulated in childhood adrenocortical tumors.
17463287 2007 NOV (CCN3) functions as a regulator of human hematopoietic stem or progenitor cells.
17340618 2007 Antiproliferative activity of CCN3: involvement of the C-terminal module and post-translational regulation.
17163153 2006 The CCN3 protein and cancer.
17101694 2006 CCN3 controls 3D spatial localization of melanocytes in the human skin through DDR1.
16675545 2006 Decreased expression of the angiogenic regulators CYR61 (CCN1) and NOV (CCN3) in human placenta is associated with pre-eclampsia.
16670264 2006 A novel mechanism for BCR-ABL action: stimulated secretion of CCN3 is involved in growth and differentiation regulation.
16600215 2006 NOV/CCN3 impairs muscle cell commitment and differentiation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16145471 2005 The expression of NOV and WT1 in renal cell carcinoma: a quantitative reverse transcriptase-polymerase chain reaction analysis.
15824736 2005 In Ewing's sarcoma CCN3(NOV) inhibits proliferation while promoting migration and invasion of the same cell type.
15611078 2005 Integrin-dependent functions of the angiogenic inducer NOV (CCN3): implication in wound healing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15213231 2004 CCN3 (NOV) interacts with connexin43 in C6 glioma cells: possible mechanism of connexin-mediated growth suppression.
15181016 2004 Connexin43 interacts with NOV: a possible mechanism for negative regulation of cell growth in choriocarcinoma cells.
15053922 2004 Three members of the connective tissue growth factor family CCN are differentially regulated by mechanical stress.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14606958 2003 CCN3 and calcium signaling.
14519668 2003 NOVH increases MMP3 expression and cell migration in glioblastoma cells via a PDGFR-alpha-dependent mechanism.
12902636 Adhesion of endothelial cells to NOV is mediated by the integrins alphavbeta3 and alpha5beta1.
12695522 2003 CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family.
12519873 2003 Characterization of human NOV in biological fluids: an enzyme immunoassay for the quantification of human NOV in sera from patients with diseases of the adrenal gland and of the nervous system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12147716 2002 A role for CCN3 (NOV) in calcium signalling.
12050162 2002 The nephroblastoma overexpressed gene (NOV/ccn3) protein associates with Notch1 extracellular domain and inhibits myoblast differentiation via Notch signaling pathway.
11502835 2001 Altered expression of novH is associated with human adrenocortical tumorigenesis.
10852911 2000 Muscarinic acetylcholine receptors induce the expression of the immediate early growth regulatory gene CYR61.
10474687 1999 Nuclear localisation of NOVH protein: a potential role for NOV in the regulation of gene expression.
10084601 1999 Binding properties and distribution of insulin-like growth factor binding protein-related protein 3 (IGFBP-rP3/NovH), an additional member of the IGFBP Superfamily.
9927660 1999 The C-terminal domain of the regulatory protein NOVH is sufficient to promote interaction with fibulin 1C: a clue for a role of NOVH in cell-adhesion signaling.
8622864 1996 Regulation of nov by WT1: a potential role for nov in nephrogenesis.
7520150 1994 Structural analysis of the human nov proto-oncogene and expression in Wilms tumor.
1756408 1991 Expression of a gene encoding a novel potential IGF binding protein in human tissues.
1334251 1992 Physical mapping of human loci homologous to the chicken nov proto-oncogene.