Property Summary

Ligand Count 63
NCBI Gene PubMed Count 5
PubMed Score 161.56
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.4e-22
Disease Target Count Z-score Confidence
Dentin dysplasia 19 3.723 1.9
Tracheal stenosis 23 3.55 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 6.4e-22

PDB (12)

Gene RIF (3)

AA Sequence

MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQV      1 - 70
KSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRY     71 - 140
DTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQE    141 - 210
VVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCV    211 - 280
DTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVH    281 - 350
LTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHD    351 - 420
SHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLG    421 - 490
MLSNGS                                                                    491 - 496
//

Text Mined References (9)

PMID Year Title