Property Summary

NCBI Gene PubMed Count 2
PubMed Score 192.03
PubTator Score 2.33

Knowledge Summary


No data available


  Disease (1)

AA Sequence

YQKQQKLRAAVTSAEAASLDEPSSSSIASIQSDDAESGVDG                                 211 - 251

Text Mined References (3)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15231714 2004 The mouse homeobox gene Not is required for caudal notochord development and affected by the truncate mutation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.