Property Summary

NCBI Gene PubMed Count 145
PubMed Score 520.19
PubTator Score 176.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.623 1.1e-03
non-small cell lung cancer -1.539 4.4e-19
lung cancer -1.600 8.2e-05
breast carcinoma -1.500 2.1e-04
fibroadenoma -1.600 1.3e-02
interstitial cystitis 1.100 5.6e-04
lung adenocarcinoma -2.000 6.1e-13
ductal carcinoma in situ -1.100 1.1e-03
invasive ductal carcinoma -1.200 7.3e-03

 IMPC Phenotype (1)

Gene RIF (123)

PMID Text
26605328 data are consistent with those obtained in previous studies that suggested that rs204993 is associated with schizophrenia and that the AA genotype of rs204993 demonstrates a higher risk
26530164 The expression of cytoplasmic Notch1 or nuclear Notch4 could also be upregulated by HBx in HepG2X cells. The upregulation of Notch1 by HBx was through p38 MAPK pathway.
26387946 Anti-estrogen resistance in human breast tumors is driven by JAG1-NOTCH4-dependent cancer stem cell activity.
26341090 High Notch4 expression is associated with Prostatic Intraepithelial Neoplasia.
25846406 Notch 3 and 4, and not Notch 1, were highly increased in human arteriovenous malformations.
25845235 The associations of rs2616984 in CSMD1 gene, putative associations of rs3131296 in NOTCH4 gene, and associations of rs2229741 of NRIP1 gene with Alzheimer's disease have been found in a Russian population.
25740432 Our findings provide a novel mechanism for Notch4-ICD regulation, suggesting a negative regulatory role for the PI3K-AKT pathway in Notch4 nuclear signaling.
25663545 BITC-mediated inhibition of bCSC was augmented by knockdown of Notch4 and Nicastrin, but not by RNA interference of Notch1 or Notch2.
25529856 NOTCH4 polymorphism can influence clinical symptoms in Slovenian patients with schizophrenia.
25511451 Study shows that Notch4 activation can promote gastric cancer growth by inducing Wnt1/b-catenin signaling.
25142293 This study failed to replicate the significant association between the NOTCH4 gene rs3131296 polymorphism and the risk for schizophrenia.
25031748 this study reveals that aberrant expression of Notch receptors 1 and 4 might play important roles during intrahepatic cholangiocarcinoma progression
25030430 A genome-wide significant association with cryoglobulin-related vasculitis was identified with SNPs near NOTCH4.
24919951 This paper demonstrated that Nicastrin and Notch4 are key molecules involved in resistance to endocrine therapy. The data suggest that targeting Notch4 and Nicastrin is a potential approach to reverse endocrine resistance in breast cancer patients.
24403446 NOTCH4 overexpression is associated with triple-negative breast cancer.
24373503 A possible contribution of Notch4 signalling to the development of brain arteriovenous malformations in human.
24305720 High Notch4 expression is associated with glioblastoma multiforme.
24151014 The expression of NOTCH4 in the dorsolateral prefrontal cortex and amygdala is decreased in suicide victims compared to control brain.
23749167 Thymosin beta4 increased Notch1 and Notch4 expression in a dose and time-dependent manner.
23742774 Notch1 and Notch4 could be used as immunohistochemical biomarkers to detect patients with a shorter disease-specific survival.
23587900 This study supports the involvement of Notch2 and Notch4 in the pathogenesis of psoriasis vulgaris. Participation of Notch2 seems more evident in male patients, possibly early onset, while that of Notch4 is more evident in late onset female patients.
23576639 Notch4-dependent antagonism of canonical TGF-beta1 signaling defines unique temporal fluctuations of SMAD3 activity in proximal tubular epithelial cells exposed to shear stress.
23566281 Our study shows that genetic variations within the NOTCH4 gene significantly modify the clinical characteristics of migraine and may have a role in disease pathogenesis.
23549433 This NOTCH4 missense mutation decreased the risk for developing multiple sclerosis in Japanese, but did not affect clinical features of those who had already developed the disease
23450325 RNAi directed against Notch-4 markedly decreased Notch-4 gene expression.
23444212 Data indicate that the expression of Notch-2 and Notch-4 receptors was higher in the GFP-bright population whereas Notch-1 and Notch-3 receptors were more expressed in GFP-dim population.
23318300 We provide the first genetic evidence suggesting the involvement of NOTCH4 polymorphisms in rheumatoid inflammatory process.
23237809 These data suggest that N4IC promoted proliferation through modulating the ERK pathway and the cell cycle during the early stage of 3T3-L1 adipogenesis and facilitated differentiation through up-regulating adipogenic genes such as C/EBPalpha, PPARgamma, aP2, LPL and HSL during the middle and late stages of 3T3-L1 adipogenesis.
23212060 strong association between expression and bipolar disorder
23015403 The length of (CA)n in EGFR and (CTG)n in NOTCH4 was not associated with breast cancer (OR=0.99; 95% CI 0.59-1.37; p=0.619 and OR=1.08; 95% CI 0.71-1.65; p=0.725, respectively).
22732452 the NOTCH4 polymorphisms, the minor allele of rs422951 and the 12-repeat variation for rs72555375, can be considered to be markers for sporadic inclusion body myositis susceptibility
22694956 Genome-wide association study of age-related macular degeneration identifies TNXB, FKBPL and NOTCH4 as candidate susceptibility genes.
22641179 The results of this study provided stringent support for previous genetic findings reporting the association of an intronic SNP (rs3131296, chr6: 32 172 993 bp on hg19) in NOTCH4 in a European cohort.
22488909 The NOTCH4 polymorphisms most strongly associated with schizophrenia exert their effects on susceptibility by altering the efficiency and/or alternative splicing of Notch4 transcripts.
22084425 Notch-1 and Notch-4 receptors are overexpressed in tumor and vascular endothelial cells in triple-negative breast cancer.
22066479 Detection of Notch1, Notch4, and DLL4 in thyroid glands and their regulation in various pathologies suggest that this pathway may play a role in thyroid carcinogenesis and angiogenesis.
22001063 Functional interaction of Notch4(ICD) and Elongin C provides novel insight into regulation of Notch signaling in epithelial cell biology and disease.
21864059 arachidonic acid significantly decreased methylation of the promoters of both KDR and Notch4 genes in Human umbilical vein endothelial cells.
21726900 The receptors Notch2, -3, -4 and their ligands Jagged1, -2 and Delta1, -4 were detected at both the mRNA and protein level in early and late placenta
21679465 results from this study demonstrate that Notch-1 and Notch-4 are novel transcriptional targets of PEA3 in breast cancer cells
21602525 The stromal cell-mediated antiapoptotic effect on B- ALL cells is mediated by Notch-3 and -4 or Jagged-1/-2 and DLL-1 in a synergistic manner.
21203870 Only rs17604492 single nucleotide polymorphism of NOTCH4 gene was found to be weakly associated with susceptibility to Kawasaki Disease (KD) in a Korean population. Results indicate NOTCH4 doesn't contribute to susceptibility to KD.
21159651 Study identifies an important role for cross talk between Notch4 and Nodal in metastatic melanoma, placing Notch4 upstream of Nodal.
21124806 Data show no detectable difference in the DNA binding site preferences of CSL before and after loading of four different Notch receptors and MAML1 proteins.
21085055 This research examined the methylation status of a region surrounding the NOTCH4 -25 C/T site in leukocyte genomic DNA and human brain regions.
21085055 Observational study of gene-disease association. (HuGE Navigator)
21045140 Studies indicate that different receptors and ligands expression in breast cancer and various ways in which the pathway can be inhibited.
20832056 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20673877 Observational study of gene-disease association. (HuGE Navigator)
20643108 The implication of a dysregulated Notch pathway to endothelial and vascular dysfunction.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20596622 Notch-4 may play an important role in salivary adenoid cystic carcinoma.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20554499 Notch 4 receptors and their ligands play differential roles in the cytodifferentiation of squamous odontogenic tumors of the mandible.
20444726 Notch-1, Notch-4, and Jagged-1 are highly expressed in different subcellular locations in the breast cancer cell
20331378 Observational study of gene-disease association. (HuGE Navigator)
20069356 The pattern of Notch gene expression mirrors the progression from immature cells to endothelial-lined vascular channels (i.e., endothelial differentiation) that characterizes the growth and involution of infantile hemangioma.
20068161 Notch4 signaling activity was 8-fold higher in breast cancer stem cell-enriched cell populations compared with differentiated cells, whereas Notch1 signaling activity was 4-fold lower in the stem cell-enriched cell populations.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19659809 Observational study of gene-disease association. (HuGE Navigator)
19404845 The expression levels of Notch1 and Notch4 were absent or significantly decreased in renal cell carcinoma tissues
19242354 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19143821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19143814 Observational study of gene-disease association. (HuGE Navigator)
19116923 Observational study of gene-disease association. (HuGE Navigator)
18593923 Combinations of antiestrogens and Notch inhibitors may be effective in ERalpha(+) breast cancers; Notch signaling is a potential therapeutic target in ERalpha(-) breast cancers.
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18239137 Present a novel mechanism by which a balance between Notch-1/-2/-4 signaling, via CBF-1, and HRT-1/-2 activity determines the expression of smooth muscle differentiation markers including actin.
18184405 NOTCH2, NOTCH3 and NOTCH4 genes are rarely mutated in common human cancers.
17920003 Expression of Notch 4 receptors was upregulated and Notch signaling might be involved in development of hepatocellular carcinoma.
17822320 Overexpression of notch4 is associated with breast cancer
17696940 Suggest an aberrant expression of Notch3 and Notch4 in HCC and allow the hypothesis of an activation of Notch signalling by Notch3.
17496152 NOTCH4 decreases are associated with vascular function decline during pulmonary fibrosis.
17452726 Observational study of gene-disease association. (HuGE Navigator)
17452726 SNPs studied are not associated with Alzheimer's disease(AD). Linkage disequilibrium of this locus indicates genetic heterogeneity in Notch4 gene. Potential markers nearby the 5' untranslated region polymorphism might affect risk for AD.
17192952 Observational study of gene-disease association. (HuGE Navigator)
17192952 Association of the TNXB locus or its adjacent region of the NOTCH4 locus with schizophrenia.
17054719 Observational study of gene-disease association. (HuGE Navigator)
17054719 A modest association was found between schizophrenia and the distal genomic region of NOTCH4 in this Taiwanese family sample.
16969274 Observational study of gene-disease association. (HuGE Navigator)
16894623 Meta-analysis of gene-disease association. (HuGE Navigator)
16894623 NOTCH4 gene may be associated with schizophrenia but how the gene contributes to the etiology of the illness needs a further investigation.
16538185 Observational study of gene-disease association. (HuGE Navigator)
16538185 The 3 SNPs (rs367398, rs2071282, & rs422952)are not associated with the onset of schizophrenia. The linkage disequilibrium of this locus indicates that there is genetic heterogeneity in the Notch4 gene.
16378929 NOTCH4 or neighboring gene might be a common susceptible gene for schizophrenia and mood disorders.
16378929 Observational study of gene-disease association. (HuGE Navigator)
16007227 Notch4 intracellular domain attenuates TGF-beta signaling in several cell types.
15684396 Vascular angiogenic factors reprogrammed the endogenous NOTCH4 gene in HeLa cells from a repressed to a transcriptionally active state.
15653273 Meta-analysis of gene-disease association. (HuGE Navigator)
15531924 Notch4/Int3 ICD-induced block to mammary gland development and tumorigenesis are consequences of an increasing gradient of CBF1-dependent Notch4/Int3 signaling
15211628 Observational study of gene-disease association. (HuGE Navigator)
15211628 no clear evidence for an association between the NOTCH4 gene and schizophrenia in the Japanese population; however, the distribution of single nucleotide polymorphism SNP2 was significantly deviated from Hardy-Weinberg equilibrium in patients
15187023 Notch4 intracellular region reduced VEGF receptor-2 (VEGFR-2) and vascular endothelial (VE)-cadherin expression.
15115916 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15091315 4 functional SNPs (rs367398, rs915894, rs520692 & rs422951) at the NOTCH4 locus among 141 schizophrenic family trios of Chinese Han descent. Of these 4 SNPs, rs520692 was the only one associated with schizophrenia.
15009827 The finding of the present study could not support the original findings that the NOTCH4 gene itself is associated with susceptibility to schizophrenia.
14966150 Observational study of gene-disease association. (HuGE Navigator)
14961038 Transduction with deletion mutants of Int-3 defined the importance of individual domains of the protein (in particular, the ANK domain and the C-terminal domain) in the inhibition of differentiation and growth arrest of HL-60 cells.
14732589 Observational study of gene-disease association. (HuGE Navigator)
14732589 The haplotype -1725G/-25T associates to schizophrenia in AA subjects (p =.0008), but not in EA subjects. Alleles -1725G and allele -25T are in positive LD both in AAs and EAs. Allele and haplotype frequencies differ significantly between AAs and EAs.
14730600 Observational study of gene-disease association. (HuGE Navigator)
14701863 Notch4 activation inhibits apoptosis through multiple pathways and provides one mechanism to explain the remarkable capacity of endothelial cells to withstand apoptosis
14651518 Observational study of gene-disease association. (HuGE Navigator)
12873802 NOTCH4 is not a significant susceptibility gene for schizophrenia when clinical heterogeneity is ignored; however, NOTCH4 may be associated with early-onset schizophrenia or schizophrenia with many negative symptoms.
12814948 Notch4 signaling in vascular endothelial cells.
12782960 Observational study of gene-disease association. (HuGE Navigator)
12782960 NOTCH4 T-25C polymorphism has an important effect on the age of onset in schizophrenia.
12627456 Observational study of gene-disease association. (HuGE Navigator)
12627456 Findings may reflect the interaction of NOTCH4 with the underlying genetic and phenotypic complexity that characterizes both schizophrenia and normal cognition and brain development.
12605097 Observational study of gene-disease association. (HuGE Navigator)
12605097 The investigated NOTCH4 variants do not have a major influence on susceptibility to schizophrenia or related neurobiological traits.
12589427 Observational study of gene-disease association. (HuGE Navigator)
12589427 significant association of alopecia areata in the overall data set with the Notch4(T+1297C) polymorphism (P<0.001) but not with Notch4(A+3063G)
11909975 Activated Notch4 inhibits angiogenesis: role of beta 1-integrin activation.
11901359 Genetic analysis of (CTG)n polymorphism in bipolar pedigrees
11836628 expressed in human osteoblastic cells and that the expression is differentially regulated upon stimulation with osteogenic factors
11803454 Observational study of gene-disease association. (HuGE Navigator)
11803454 The Notch gene family regulates embryonic cell migration, vascular morphogenesis and remodeling. The Notch 4 locus has been implicated in schizophrenia, but this study rules out a significant role for the Notch4 gene in schizophrenia in the Han Chinese.
11407996 Observational study of gene-disease association. (HuGE Navigator)
11381258 Observational study of gene-disease association. (HuGE Navigator)
11381257 Observational study of gene-disease association. (HuGE Navigator)
11239712 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGETCQFPDPCQN      1 - 70
AQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLEDPCPPSFCSKRGRCHIQASGR     71 - 140
PQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTS    141 - 210
CHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNC    211 - 280
VSHQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGT    281 - 350
SCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC    351 - 420
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTC    421 - 490
LDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPC    491 - 560
ANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCA    561 - 630
PNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPC    631 - 700
AHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDY    701 - 770
CVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS    771 - 840
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDS    841 - 910
GPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNH    911 - 980
GTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPC    981 - 1050
HSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGY   1051 - 1120
GGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAG   1121 - 1190
CSGPGGNWDGGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH   1191 - 1260
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLRVGLWVR   1261 - 1330
KDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAGFVVVMGVDLSRCGPDHPASR   1331 - 1400
CPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPPANQLPWPVLCSPVAGVILLALGALLVLQL   1401 - 1470
IRRRRREHGALWLPPGFTRRPRTQSAPHRRRPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQA   1471 - 1540
EETGPPSTCQLWSLSGGCGALPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWL   1541 - 1610
GCPEPWEPLLDGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR   1611 - 1680
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARAA   1681 - 1750
RSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLE   1751 - 1820
GAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPRCRTLSAGAGPRGGGACLQARTWSVDLAARG   1821 - 1890
GGAYSHCRSLSGVGAGGGPTPRGRRFSAGMRGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACG   1891 - 1960
SASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGEGKK                              1961 - 2003
//

Text Mined References (146)

PMID Year Title
26605328 2015 Association of the NOTCH4 Gene Polymorphism rs204993 with Schizophrenia in the Chinese Han Population.
26530164 2016 Hepatitis B virus X protein activates Notch signaling by its effects on Notch1 and Notch4 in human hepatocellular carcinoma.
26387946 2015 Anti-estrogen Resistance in Human Breast Tumors Is Driven by JAG1-NOTCH4-Dependent Cancer Stem Cell Activity.
26341090 2016 Characterization of Notch Signalling Pathway Members in Normal Prostate, Prostatic Intraepithelial Neoplasia (PIN) and Prostatic Adenocarcinoma.
25846406 2015 Notch receptor expression in human brain arteriovenous malformations.
25845235 [Replicative association analysis of genetic markers of cognitive traits with Alzheimer's disease in a Russian population].
25740432 2015 AKT and 14-3-3 regulate Notch4 nuclear localization.
25663545 2015 The role of polycomb group protein Bmi-1 and Notch4 in breast cancer stem cell inhibition by benzyl isothiocyanate.
25529856 2015 Genetic variability testing of neurodevelopmental genes in schizophrenic patients.
25511451 2015 Notch4 promotes gastric cancer growth through activation of Wnt1/?-catenin signaling.
25142293 2014 Association between the NOTCH4 gene rs3131296 polymorphism with schizophrenia risk in the Chinese Zhuang population and Chinese Han population.
25053477 2014 Introduction to Notch signaling.
25031748 2014 Clinicopathological significance of aberrant Notch receptors in intrahepatic cholangiocarcinoma.
25030430 2014 Genome-wide association study of hepatitis C virus- and cryoglobulin-related vasculitis.
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
24919951 2014 Nicastrin and Notch4 drive endocrine therapy resistance and epithelial to mesenchymal transition in MCF7 breast cancer cells.
24837172 2015 Genome-wide association scan in north Indians reveals three novel HLA-independent risk loci for ulcerative colitis.
24403446 2014 NOTCH4 is a potential therapeutic target for triple-negative breast cancer.
24373503 2013 Notch4 is activated in endothelial and smooth muscle cells in human brain arteriovenous malformations.
24305720 2014 Differential patterns of NOTCH1-4 receptor expression are markers of glioma cell differentiation.
24151014 2014 Abnormal expression pattern of Notch receptors, ligands, and downstream effectors in the dorsolateral prefrontal cortex and amygdala of suicidal victims.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23749167 2013 Thymosin beta4 induces angiogenesis through Notch signaling in endothelial cells.
23742774 2013 Notch1 and Notch4 are markers for poor prognosis of hepatocellular carcinoma.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
23587900 2013 notch2, notch4 gene polymorphisms in psoriasis vulgaris.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23576639 2013 Notch4-dependent antagonism of canonical TGF-?1 signaling defines unique temporal fluctuations of SMAD3 activity in sheared proximal tubular epithelial cells.
23566281 2013 Genetic variants in the NOTCH4 gene influence the clinical features of migraine.
23549433 2013 A NOTCH4 missense mutation confers resistance to multiple sclerosis in Japanese.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23450325 2013 Lentiviral-mediated gene silencing of Notch-4 inhibits in vitro proliferation and perineural invasion of ACC-M cells.
23444212 2013 Notch pathway activity identifies cells with cancer stem cell-like properties and correlates with worse survival in lung adenocarcinoma.
23326239 2013 A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).
23318300 2013 Genetic evidence for the involvement of NOTCH4 in rheumatoid arthritis and alopecia areata.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23237809 2013 Active form Notch4 promotes the proliferation and differentiation of 3T3-L1 preadipocytes.
23212060 2012 Up-regulation of NOTCH4 gene expression in bipolar disorder.
23028341 2012 Genome-wide association study for serum complement C3 and C4 levels in healthy Chinese subjects.
23015403 2012 Microsatellite polymorphisms in the EGFR, NOTCH4 and E2F4 genes and their association with breast cancer risk.
22732452 2012 Investigation of NOTCH4 coding region polymorphisms in sporadic inclusion body myositis.
22694956 2012 Genome-wide association study of age-related macular degeneration identifies associated variants in the TNXB-FKBPL-NOTCH4 region of chromosome 6p21.3.
22641179 2013 Genetic evidence for association between NOTCH4 and schizophrenia supported by a GWAS follow-up study in a Japanese population.
22488909 2012 A re-review of the association between the NOTCH4 locus and schizophrenia.
22084425 2012 Notch-1 and Notch-4 biomarker expression in triple-negative breast cancer.
22066479 2011 Delta-like 4/Notch pathway is differentially regulated in benign and malignant thyroid tissues.
22001063 2011 Elongin C is a mediator of Notch4 activity in human renal tubule cells.
21864059 2011 The CpG island methylation regulated expression of endothelial proangiogenic genes in response to ?-carotene and arachidonic acid.
21804548 2011 Genome-wide association study identifies three new susceptibility loci for adult asthma in the Japanese population.
21779181 2011 Identification of novel genetic markers associated with clinical phenotypes of systemic sclerosis through a genome-wide association strategy.
21726900 2011 Expression patterns of Notch receptors and their ligands Jagged and Delta in human placenta.
21679465 2011 NOTCH-1 and NOTCH-4 are novel gene targets of PEA3 in breast cancer: novel therapeutic implications.
21602525 2011 Notch-3 and Notch-4 signaling rescue from apoptosis human B-ALL cells in contact with human bone marrow-derived mesenchymal stromal cells.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
21203870 2011 Notch homolog 4 polymorphism and Kawasaki disease.
21159651 2010 Regulation of the embryonic morphogen Nodal by Notch4 facilitates manifestation of the aggressive melanoma phenotype.
21124806 2010 Notch and MAML-1 complexation do not detectably alter the DNA binding specificity of the transcription factor CSL.
21085055 2011 Methylation analysis of the NOTCH4 -25 C/T polymorphism in schizophrenia.
21045140 2010 Breast cancer stem cells: something out of notching?
20832056 2011 Genome-wide association study of schizophrenia in a Japanese population.
20673877 2010 Common variants in major histocompatibility complex region and TCF4 gene are significantly associated with schizophrenia in Han Chinese.
20643108 2010 Inflammation dysregulates Notch signaling in endothelial cells: implication of Notch2 and Notch4 to endothelial dysfunction.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20596622 2010 Notch-4 contributes to the metastasis of salivary adenoid cystic carcinoma.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20554499 2010 Squamous odontogenic tumor of the mandible: a case report demonstrating immunoexpression of Notch1, 3, 4, Jagged1 and Delta1.
20444726 2011 Notch-1 and notch-4 receptors as prognostic markers in breast cancer.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20069356 2010 A switch in Notch gene expression parallels stem cell to endothelial transition in infantile hemangioma.
20068161 2010 Regulation of breast cancer stem cell activity by signaling through the Notch4 receptor.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19659809 2009 Confirmation of the novel association at the BTNL2 locus with ulcerative colitis.
19571808 2009 Common variants conferring risk of schizophrenia.
19404845 2009 Expression and clinical significance of Notch receptors in human renal cell carcinoma.
19242354 2009 The tumor necrosis factor polymorphism TNF (-308) is associated with susceptibility to meningococcal sepsis, but not with lethality.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19143821 2009 Association of MHC SNP genotype with susceptibility to type 1 diabetes: a modified survival approach.
19143814 2009 Several loci in the HLA class III region are associated with T1D risk after adjusting for DRB1-DQB1.
19116923 2009 Genetic association of the major histocompatibility complex with rheumatoid arthritis implicates two non-DRB1 loci.
18663143 2008 Slug is a direct Notch target required for initiation of cardiac cushion cellularization.
18593923 2008 Cross-talk between notch and the estrogen receptor in breast cancer suggests novel therapeutic approaches.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18239137 2008 Hairy-related transcription factors inhibit Notch-induced smooth muscle alpha-actin expression by interfering with Notch intracellular domain/CBF-1 complex interaction with the CBF-1-binding site.
18184405 2007 Mutational analysis of NOTCH1, 2, 3 and 4 genes in common solid cancers and acute leukemias.
17920003 2008 Deregulated expression of Notch receptors in human hepatocellular carcinoma.
17822320 2007 A study on Notch signaling in human breast cancer.
17696940 2007 Aberrant Notch3 and Notch4 expression in human hepatocellular carcinoma.
17496152 2007 Genomic profile of matrix and vasculature remodeling in TGF-alpha induced pulmonary fibrosis.
17452726 2007 Genetic association between Notch4 polymorphisms and Alzheimer's disease in the Japanese population.
17192952 2007 Association study between the TNXB locus and schizophrenia in a Japanese population.
17054719 2007 Association evidence of schizophrenia with distal genomic region of NOTCH4 in Taiwanese families.
16969274 2006 No evidence for association between NOTCH4 and schizophrenia in a large family-based and case-control association analysis.
16894623 2006 A review and re-evaluation of an association between the NOTCH4 locus and schizophrenia.
16538185 2006 Genetic association between Notch4 polymorphisms and Japanese schizophrenics.
16378929 2005 [Association study of NOTCH4 gene polymorphisms with schizophrenia and mood disorders in mixed pedigrees].
16007227 2005 Notch4 intracellular domain binding to Smad3 and inhibition of the TGF-beta signaling.
15684396 2005 Molecular determinants of NOTCH4 transcription in vascular endothelium.
15653273 2005 Five NOTCH4 polymorphisms show weak evidence for association with schizophrenia: evidence from meta-analyses.
15531924 2004 Mammary development and tumorigenesis in mice expressing a truncated human Notch4/Int3 intracellular domain (h-Int3sh).
15211628 2004 Association of six polymorphisms of the NOTCH4 gene with schizophrenia in the Japanese population.
15187023 2004 Notch4-induced inhibition of endothelial sprouting requires the ankyrin repeats and involves signaling through RBP-Jkappa.
15115916 2004 Interaction between NOTCH4 and catechol-O-methyltransferase genotypes in schizophrenia patients with poor response to typical neuroleptics.
15091315 2004 Is NOTCH4 associated with schizophrenia?
15009827 2004 Transmission disequilibrium test and haplotype analysis of the NOTCH4 gene in Japanese patients with schizophrenia.
14966150 2004 Association study of Notch 4 polymorphisms with Alzheimer's disease.
14961038 2004 Expression of constitutively active Notch4 (Int-3) modulates myeloid proliferation and differentiation and promotes expansion of hematopoietic progenitors.
14732589 2004 NOTCH4 gene haplotype is associated with schizophrenia in African Americans.
14730600 2004 Analysis of single-nucleotide polymorphisms in Japanese rheumatoid arthritis patients shows additional susceptibility markers besides the classic shared epitope susceptibility sequences.
14701863 2004 Notch4 inhibits endothelial apoptosis via RBP-Jkappa-dependent and -independent pathways.
14651518 2004 A NOTCH4 association with multiple sclerosis is secondary to HLA-DR*1501.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12873802 2003 Family-based association study of the NOTCH4 gene in schizophrenia using Japanese and Chinese samples.
12814948 2003 Notch signaling in primary endothelial cells.
12782960 2003 NOTCH4 gene promoter polymorphism is associated with the age of onset in schizophrenia.
12627456 2003 NOTCH4 and the frontal lobe in schizophrenia.
12605097 2003 Two NOTCH4 polymorphisms and their relation to schizophrenia susceptibility and different personality traits.
12589427 2003 Notch4, a non-HLA gene in the MHC is strongly associated with the most severe form of alopecia areata.
12496471 Notch signaling in cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370315 2002 Identification of a family of mastermind-like transcriptional coactivators for mammalian notch receptors.
11909975 2002 Activated Notch4 inhibits angiogenesis: role of beta 1-integrin activation.
11836628 2002 Differential expression of Notch genes in human osteoblastic cells.
11823422 2002 Integrity of intracellular domain of Notch ligand is indispensable for cleavage required for release of the Notch2 intracellular domain.
11585921 2001 SEL-10 is an inhibitor of notch signaling that targets notch for ubiquitin-mediated protein degradation.
11532344 2001 Notch receptors and hematopoiesis.
11518718 2001 Murine notch homologs (N1-4) undergo presenilin-dependent proteolysis.
11407996 2001 The (CTG)n polymorphism in the NOTCH4 gene is not associated with schizophrenia in Japanese individuals.
11381258 2001 Failure to confirm NOTCH4 association with schizophrenia in a large population-based sample from Scotland.
11381257 2001 Association analysis of NOTCH4 loci in schizophrenia using family and population-based controls.
11239712 2001 NOTCH4 gene polymorphism and susceptibility to schizophrenia and schizoaffective disorder.
11119607 2001 An Epstein-Barr virus protein interacts with Notch.
11112321 2000 Notch signaling: from the outside in.
11101851 2000 MAML1, a human homologue of Drosophila mastermind, is a transcriptional co-activator for NOTCH receptors.
11078798 2000 Imbalanced expression of TAN-1 and human Notch4 in endometrial cancers.
10932176 2000 The NOTCH4 locus is associated with susceptibility to schizophrenia.
10645000 2000 Identification of a novel NOTCH-4/INT-3 RNA species encoding an activated gene product in certain human tumor cell lines.
10221902 1999 Notch signaling: cell fate control and signal integration in development.
10079256 1999 Human ligands of the Notch receptor.
9693032 1998 Cloning, characterization, and the complete 56.8-kilobase DNA sequence of the human NOTCH4 gene.
9576833 1998 Notch4 and Wnt-1 proteins function to regulate branching morphogenesis of mammary epithelial cells in an opposing fashion.
9168133 1997 Gene organization of human NOTCH4 and (CTG)n polymorphism in this human counterpart gene of mouse proto-oncogene Int3.
8681805 1996 Notch4/int-3, a mammary proto-oncogene, is an endothelial cell-specific mammalian Notch gene.
7835890 1994 Three genes in the human MHC class III region near the junction with the class II: gene for receptor of advanced glycosylation end products, PBX2 homeobox gene and a notch homolog, human counterpart of mouse mammary tumor gene int-3.
7671825 1995 Deltex acts as a positive regulator of Notch signaling through interactions with the Notch ankyrin repeats.