Property Summary

NCBI Gene PubMed Count 182
PubMed Score 253.67
PubTator Score 221.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytoma 3.100 1.2e-03
glioblastoma 1.800 1.6e-03
urothelial carcinoma -1.300 2.6e-02
malignant mesothelioma -3.100 2.2e-07
ependymoma 2.100 1.2e-08
psoriasis -3.100 2.7e-05
osteosarcoma -2.243 3.2e-07
group 4 medulloblastoma -2.900 3.7e-06
atypical teratoid / rhabdoid tumor 2.700 7.9e-07
medulloblastoma, large-cell -2.700 8.8e-04
Duchenne muscular dystrophy 1.446 3.1e-07
autosomal dominant Emery-Dreifuss muscul... 1.360 1.0e-02
juvenile dermatomyositis 1.446 2.3e-11
acute quadriplegic myopathy 1.179 3.6e-04
lung cancer -2.300 3.4e-06
pediatric high grade glioma 1.700 1.1e-03
pilocytic astrocytoma 1.400 6.4e-04
COPD -1.100 2.1e-03
lung carcinoma -2.100 2.4e-43
ovarian cancer 1.600 5.7e-04
pituitary cancer -1.600 3.7e-05
Down syndrome 1.200 1.0e-02

 GWAS Trait (1)

 CSPA Cell Line (4)

Gene RIF (152)

PMID Text
26640406 Notch2 and Notch3 inhibited both cell proliferation and cell apoptosis in BeWo and JAR trophoblast cell lines.
26427670 suggest that Notch2 has an essential role in the cell growth, invasion, and migration of SACC. Notch2 may therefore be a potential target gene for the treatment of SACC by interfering with cell growth and metastasis
26252838 These findings suggested that the NOTCH2 signaling may confer aggressive behavior and immature morphology in human hepatocellular carcinoma cells.
26165719 A functional polymorphism in the premiR146a gene influences the prognosis of glioblastoma multiforme by interfering with the balance between Notch1 and Notch2
26041884 Notch signaling sustains chronic lymphocytic leukemia cell survival by promoting Mcl-1 expression and eIF4E activity, and given the oncogenic role of these factors, underscores the therapeutic potential of Notch inhibition in chronic lymphocytic leukemia.
26041881 Results suggest that Notch2 pathway and miR-23b interplay in a reciprocal regulation loop in gastric cancer cells and this axis plays an important role in gastric carcinogenesis.
26018735 NOTCH2 inhibition triggers the Epstein-Barr virus lytic cycle and cell apoptosis; and NOTCH2 inhibition may represent an appealing therapeutic strategy against Epstein-Barr virus-associated malignancies.
25992613 miR-191 represses proliferation in primary human fibroblasts via targeting multiple proto-oncogenes, including CDK9, NOTCH2, and RPS6KA3.
25985737 C8orf4 negatively regulates the self-renewal of liver CSCs via suppression of NOTCH2 signalling
25957400 NOTCH2 inhibits PDGF-B-dependent proliferation and its expression is decreased by PDGF-B.
25918160 Human NOTCH2 but not mouse Notch2 is resistant to negative regulatory region perturbation and ligand-independent activation by Adam17.
25849484 High Notch2 expression is associated with chronic myeloid leukemia.
25696021 Hajdu-Cheney syndrome and serpentine fibula-polycystic kidney syndrome are a single disease entity with a wide spectrum of clinical manifestations associated with truncating mutations in exon 34 of NOTCH2.
25659500 Data suggest that expression of NOTCH2 in first-trimester placenta is cell-type specific; NOTCH2 is expressed in differentiated cells of extravillous trophoblast lineage; inhibition of NOTCH2 by RNA interference promotes trophoblast motility.
25574842 results indicate that NOTCH serves as a tumor suppressor in the bladder and that loss of this pathway promotes mesenchymal and invasive features.
25558064 Inhibition of Notch2 prevents goblet cell metaplasia induced by a broad range of stimuli.
25491639 This review establishes that gain-of-function mutations of NOTCH2 are associate with Hajdu-Cheney syndrome.
25397403 Notch2 controls prolactin and insulin-like growth factor binding protein-1 expression in decidualizing human stromal cells of early pregnancy.
25381598 High NOTCH2 expression is associated with minimal deviation adenocarcinoma of uterine cervix.
25381127 NOTCH2 mutations were associated with diffuse large B-cell lymphoma with hepatitis C virus infection.
25368376 a novel biological method that entails selection of human BMSCs based on NOTCH2 expression and activation of the NOTCH signaling pathway in cultured BMSCs via a tissue culture plate coated with recombinant human JAGGED1 (JAG1) ligand.
25338527 28 of 30 in: Mol Med Rep. 2015 Jan;11(1) Interference of Notch 2 inhibits the progression of gliomas and induces cell apoptosis by induction of the cell cycle at the G0/G1 phase
25323114 The cumulative survival rate was significantly longer in the Notch2shRNA group.
25314575 The Notch2 receptor with PEST domain truncation enhances cell proliferation which may be associated with the activation of the Notch2 and the NF-kappaB signaling.
25311243 Intracellular NOTCH1 and NOTCH2, by inducing MYC, suppressed miR-30a in B- and T-cell malignancies.
25257302 drives multiple myeloma associated osteoclast development and bone destruction
25141821 NOTCH1 and NOTCH2 mutations are uncommon in Follicular lymphoma but may occur in a subset of cases with distinctive, characteristic, clinicopathological features.
25041344 Its signaling pathway determines pathological aggressiveness of intra ductal papillary mucinous neoplasm of the pancreas.
25038880 The present study indicates that Notch2 activation by ZER inhibits its proapoptotic and anti-migratory response at least in breast cancer cells.
24995648 All three syndromes result from mutations in the gene that encodes NOTCH2.
24671051 Expression of Notch1, -2, and -3, CDK2, and CCNE1 was significantly decreased by upregulation of ALDH1A1 in A549 cells, but increased by its interruption in A549s cells.
24574459 NOTCH2 and FLT3 mis-splicing is a common characteristic of AML and has the potential to generate transcripts encoding proteins with altered function.
24489102 Knockdown of Notch1 and Notch2 genes in gammadelta T cells using small interfering RNA inhibited their antitumor cytotoxic potential
24336671 In the placentas from women with early-onset severe preeclampsia, Notch2 expression was significantly increased.
24151014 In the dorsolateral prefrontal cortex and amygdala of suicide victims, NOTCH2 expression is decreased compared to control brain.
24122995 NOTCH1 and 2 knockdown reduces the level of mechanistic target of rapamycin (mTOR) protein in the monoblastic leukemia cell line THP-1.
23999936 A gene fusion involving MIR143 in band 5q32 was identified with NOTCH2 in 1p13 in glomus tumors
23967108 genetic variation in NOTCH2 increased susceptibility to type 2 diabetes among people exposed to inorganic arsenic
23965337 Propose a receptor-specific function for Notch2 in regulating Jag-1-induced p27(kip1) expression and growth arrest in vascular smooth muscle cells.
23752887 The role of NOTCH2 and JAG1 in formation of proximal nephron structures and podocytes might explain the observed phenotypes of renal dysplasia and proteinuria in patients with Alagille syndrome.
23589286 An increase in expression of selective NOTCH receptors (NOTCH1 and -2), ligand (JAGGED2), and target genes (HES1, HEY1, and HEY2) was observed in NP cells following cytokine treatment.
23587900 This study supports the involvement of Notch2 and Notch4 in the pathogenesis of psoriasis vulgaris. Participation of Notch2 seems more evident in male patients, possibly early onset, while that of Notch4 is more evident in late onset female patients.
23549787 netrin-1 forms a complex with both Notch2 and Jagged1.
23536545 Pancreatic cancer stem cells expressing NOTCH2 are highly tumorigenic in mice.
23444212 Data indicate that the expression of Notch-2 and Notch-4 receptors was higher in the GFP-bright population whereas Notch-1 and Notch-3 receptors were more expressed in GFP-dim population.
23401378 Clinical and molecular data (NOTCH2 mutations) suggest that Hajdu-Cheney syndrome and serpentine fibula polycystic kidney syndrome are a single disorder with variable degree of expression. [Case-report and review]
23389697 The findings confirm that heterozygous NOTCH2 mutations are the cause of Hajdu-Cheney Syndrome and expand the mutational spectrum of this disorder.
23380742 These data indicate that Notch signaling controls human CD8(+) T cell priming and also influences effector T cell functions.
23349727 different role of Notch1 and Notch2 in astrocytic gliomas
23331119 an imbalanced interaction of Jagged1 expression in periductal and periportal myofibroblasts and Notch2 expressed in cholangiocytes, may be involved in the formation of bile duct lesions in Polycystic kidney rats
23326131 Notch2 may negatively regulate cell invasion by inhibiting the PI3K-Akt signaling pathway in gastric cancer
23243020 Findings indicate a critical role for the midkine-Notch2 signaling axis in neuroblastoma tumorigenesis, which implicates new strategies to treat neuroblastoma.
23011796 Data indicate that force applied to the Notch2 negative regulatory region (NRR) can indeed expose the S2 site and, crucially, allow cleavage by the metalloprotease TACE (TNF-alpha-converting enzyme).
22970250 Taken together, the GSK3B, CTNNB1 and NOTCH2 expression signature is a novel, promising prognostic parameter for gastric cancer
22915591 Characterization of CSL (CBF-1, Su(H), Lag-1) mutants reveals differences in signaling mediated by Notch1 and Notch2.
22891276 NOTCH2 mutations play a role in the pathogenesis and progression of the splenic marginal zone lymphoma and are associated with a poor prognosis.
22891273 Mutations in NOTCH2, a gene required for marginal-zone B cell development, represent the most frequent lesion in splenic marginal zone lymphoma
22717580 Notch2 signaling in NSCs produces features of GSCs and induces astrocytic lineage entry, consistent with a possible role in astrocytoma formation
22695918 Inactivating mutations are found in Notch2 signaling pathways in chronic myelomonocytic leukemia, while activating mutations are found in mature B cell lymphomas. (Review)
22526456 immunohistochemical analysis of NOTCH1-3, JAGGED1, cMET, and phospho-MAPK in 100 carcinomas of unknown primary
22209762 This work confirms the importance of NOTCH2 as a second disease gene in ALGS and expands the repertoire of the NOTCH2 related disease phenotype.
22190591 Paired upregulation of Notch2 and Six1 is a transcriptional aberration that contributes to preinvasive-to-invasive adenocarcinoma progression by inducing epithelial-mesenchymal transition and nuclear atypia.
22161246 The expression of Notch2 gene in peripheral blood mononuclear cells from B-cell chronic lymphocytic leukemia patients, was examined.
22006338 study describes a spectrum of inactivating somatic mutations of Notch receptors in lung and skin cancers, indicating that Notch loss of function plays a prominent role in multiple variants of squamous cell carcinomas
21976141 suppression of tumor progression by Notch2 knockdown in SC-M1 cells was reversed by exogenous COX-2 or its major enzymatic product PGE(2)
21793104 Serpentine fibula-polycystic kidney syndrome and Hajdu-Cheney syndrome are both conditions caused by NOTCH2 mutations.
21726900 The receptors Notch2, -3, -4 and their ligands Jagged1, -2 and Delta1, -4 were detected at both the mRNA and protein level in early and late placenta
21681853 Our results support the suggestion that modulation of the Notch pathway, and specifically NOTCH2, may be a productive therapeutic mode for treatment of typical age-related osteoporosis.
21639801 NOTCH2 expression and activation, independent of JAGGED1 expression, may contribute to the pathogenesis of hepatoblastoma.
21471519 Data show that Notch1 to -3 may have potential use as a strong prognostic fact
21466361 This study demonstrated a close correlation of Notch2 expression with gastric cancer formation and the potential link of Notch1 upregulation with intestinal-like phenotypes of gastric lesions.
21443520 Down-regulating Notch signaling may be a useful approach to inhibit the progression of pancreatic cancer
21437251 Notch-2 was identified as a novel target for beta-catenin-dependent Wnt signaling.
21378989 sequenced the exomes of six unrelated individuals with Hajdu-Cheney syndrome and identified heterozygous nonsense and frameshift mutations in NOTCH2 in five of them
21378989 Mutations in NOTCH2 are a major cause of Hajdu-Cheney syndrome
21378985 Hajdu-Cheney syndrome mutations are predicted to lead to the premature truncation of NOTCH2 with either disruption or loss of the C-terminal proline-glutamate-serine-threonine-rich proteolytic recognition sequence.
21238798 In this study, Notch 2 receptors were detected in the lining epithelium of human periapical cysts with limited inflammation, showing Notch pathway activation in those cells.
21124806 Data show no detectable difference in the DNA binding site preferences of CSL before and after loading of four different Notch receptors and MAML1 proteins.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20829885 Notch 2 contributes to stem cell factor-mediated delay of erythroid differentiation.
20816152 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20643108 The implication of a dysregulated Notch pathway to endothelial and vascular dysfunction.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20482849 expression of NOTCH2 differs in subgroups of breast tumors and by genotypes of the breast cancer-associated SNP rs11249433
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351182 Notch2- but not Notch1-deficient CD8-positive T cells fail to expand in response to tumor inoculation; Notch2 signaling directly controls cytotoxic T lymphocyte effector molecules.
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20069356 The pattern of Notch gene expression mirrors the progression from immature cells to endothelial-lined vascular channels (i.e., endothelial differentiation) that characterizes the growth and involution of infantile hemangioma.
20011512 TNF signaling activates Notch2 that sensitizes endothelial cells to apoptosis via modulation of the key apoptosis regulator survivin.
19933996 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19862325 Observational study of gene-disease association. (HuGE Navigator)
19833888 Observational study of gene-disease association. (HuGE Navigator)
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741467 Observational study of gene-disease association. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19701457 S1 cleavage has distinct effects on the surface expression of Notch1 and Notch2, but is not generally required for physiologic or pathophysiologic activation of Notch proteins
19670153 Observational study of gene-disease association. (HuGE Navigator)
19653042 Notch2 expression is decreased in colorectal cancer and related to tumor differentiation status.
19603167 Notch2 decreased statistically in immune thrombocytopenic purpura patients.
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19502414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19445024 mutant Notch2 receptors show increased activity compared with wild-type Notch2
19404845 The levels of expression of Notch2 and Notch3 were minimally detected in renal cell carcinoma tumours and non-neoplastic tissues
19339697 Notch signaling in B cells and B-cell lymphomas is only compatible with proliferation if pathways leading to antiapototic signals are active.
19330030 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19324937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19276344 Notch-2 and its ligand, Jagged-1, are highly up-regulated in gemcitabine resistant pancreatic cancer cells, which is consistent with the role of the Notch signaling pathway in the acquisition of EMT and cancer stem-like cell phenotype.
19247373 Observational study of gene-disease association. (HuGE Navigator)
19147558 In gliomas, the TNC gene is transactivated by Notch2 in an RBPJk-dependent manner mediated by an RBPJk binding element in the TNC promoter.
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19119320 Results suggest that the NOTCH2 gene is not physically rearranged by t(1;19) translocation of oligodendroglioma tumors, and that the t(1;19) translocation arises from complex intra and interchromosomal rearrangements.
19054571 Observational study of gene-disease association. (HuGE Navigator)
19020324 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18714373 Observational study of gene-disease association. (HuGE Navigator)
18703315 Wnt (Wnt2), Stat3, and Notch-1 and -2 signaling are correlated in human epidermal tumors.
18591388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18567820 Observational study of gene-disease association. (HuGE Navigator)
18508802 analysis of potentially activating mutations of NOTCH2 in 5% of MZL cases, comprising a splenic and an extranodal MZL case
18508802 Observational study of gene-disease association. (HuGE Navigator)
18372903 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18311147 activation of the Notch pathway, which is critical in glomerular patterning, contributes to the development of glomerular disease
18266235 The absence of mutations in NOTCH2 and Hey2 its downstream target in the heart does not exclude the possibility that other genes in this pathway might be implicated in the diverse phenotypes observed in Alagille syndrome
18239137 Present a novel mechanism by which a balance between Notch-1/-2/-4 signaling, via CBF-1, and HRT-1/-2 activity determines the expression of smooth muscle differentiation markers including actin.
18184405 NOTCH2, NOTCH3 and NOTCH4 genes are rarely mutated in common human cancers.
18087195 support the role of Notch and Akt in breast cancer progression
17920003 Cytoplasmic expression of Notch 2 receptors was downregulated and Notch signaling might be involved in development of hepatocellular carcinoma.
17675579 Results demonstrate that Notch2 signaling is a potent inhibitory signal in human breast cancer xenografts.
17652726 Notch family members and ligands are expressed in the human corneal epithelium and appear to play pivotal roles in corneal epithelial cell differentiation
17593975 Loss of NOTCH2 positively predicts survival in subgroups of human glial brain tumors.
17573339 NOTCHES N1, N2, and N3 all bound to FIH; results suggest the possibility that Notch ICDs are FIH substrates.
17401372 The X-ray structure of the human NOTCH2 negative regulatory region, which adopts an autoinhibited conformation, is presented.
16899352 Observational study of gene-disease association. (HuGE Navigator)
16773578 Alagille syndrome is a heterogeneous disorder and implicates NOTCH2 mutations in human disease
15976178 density of Notch ligands in different organ systems may be an important determinant in regulating cell-fate outcomes
15621797 review of mechanisms leading to the upregulation of CD23 in the leukemic cells and review of the potential functions of CD23 as well as its regulation by Notch2 in B-CLL
15565166 Loss of Notch2 activity is an early steps in PI-induced apoptosis of B-cell chronic lymphocytic leukemia lymphocytes and may be part of the full apoptotic response.
15507668 c-jun, junD, junB, and c-fos and Notch2 are expressed in splenic marginal zone lymphoma
15492845 Notch-2 could play a tumour-suppressive role in human breast cancer.
14726396 Notch receptors 1&2 and their ligand Jagged1 are highly expressed in cultured and primary MM cells, suggesting Notch signaling is involved in the tight interactions between neoplastic plasma cells and their bone marrow microenvironment
14609630 EGF-like repeats1-6 of human Notch2 interact with Tat protein of Hiv-1
14609630 HIV-1 Tat interacts with the EGF-like repeats 1-6 (amino acids 26-256) of Human Notch2, suggesting Tat might modulate Notch2 function, thus affecting various AIDS-associated pathologies
12931033 identified two proteins that interacted with the Tat protein of the caprine arthritis encephalitis virus: the EGF-like repeats 1-6 of the extracellular domain of the human Notch2 receptor and the epithelin/granulin growth factor precursor
12531696 Notch2 protein distribution in human teeth under normal and pathological conditions, and in embryo and adult.
11978185 Notch signalling involved in differentiation of normal adult human epidermis is altered under experimental conditions and pathologies which modify this program.
11836628 expressed in human osteoblastic cells and that the expression is differentially regulated upon stimulation with osteogenic factors

AA Sequence

MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEK      1 - 70
NRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGK     71 - 140
ECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCP    141 - 210
QGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVN    211 - 280
TYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPG    281 - 350
STCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA    351 - 420
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVH    421 - 490
CELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCAT    491 - 560
GFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ    561 - 630
CNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCING    631 - 700
VNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGG    701 - 770
TCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN    771 - 840
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEE    841 - 910
DIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFD    911 - 980
GVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCS    981 - 1050
CPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLC   1051 - 1120
QHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDE   1121 - 1190
CQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER   1191 - 1260
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFI   1261 - 1330
CRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSC   1331 - 1400
QCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPL   1401 - 1470
PCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPE   1471 - 1540
NLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSL   1541 - 1610
PGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY   1611 - 1680
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLI   1681 - 1750
GTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLD   1751 - 1820
VNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRA   1821 - 1890
DAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMV   1891 - 1960
AELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILL   1961 - 2030
DHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG   2031 - 2100
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMI   2101 - 2170
TSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGS   2171 - 2240
LSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLI   2241 - 2310
PKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASV   2311 - 2380
GKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGG   2381 - 2450
GQRGPGTHMSEPPHNNMQVYA                                                    2451 - 2471
//

Text Mined References (187)

PMID Year Title
26640406 2015 Effects of Notch2 and Notch3 on Cell Proliferation and Apoptosis of Trophoblast Cell Lines.
26427670 2016 Notch2 signaling contributes to cell growth, invasion, and migration in salivary adenoid cystic carcinoma.
26252838 2015 NOTCH2 signaling confers immature morphology and aggressiveness in human hepatocellular carcinoma cells.
26165719 2015 A functional polymorphism in the pre?miR?146a gene influences the prognosis of glioblastoma multiforme by interfering with the balance between Notch1 and Notch2.
26041884 2015 Notch signaling sustains the expression of Mcl-1 and the activity of eIF4E to promote cell survival in CLL.
26041881 2015 The reciprocal regulation loop of Notch2 pathway and miR-23b in controlling gastric carcinogenesis.
26018735 2015 Cross talk between EBV and telomerase: the role of TERT and NOTCH2 in the switch of latent/lytic cycle of the virus.
25992613 2015 MiR-191 Regulates Primary Human Fibroblast Proliferation and Directly Targets Multiple Oncogenes.
25985737 2015 C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.
25957400 2015 Differential Regulation of NOTCH2 and NOTCH3 Contribute to Their Unique Functions in Vascular Smooth Muscle Cells.
25918160 2015 Human NOTCH2 Is Resistant to Ligand-independent Activation by Metalloprotease Adam17.
25849484 2015 Potential role of Notch signalling in CD34+ chronic myeloid leukaemia cells: cross-talk between Notch and BCR-ABL.
25696021 2015 A novel NOTCH2 mutation identified in a Korean family with Hajdu-Cheney syndrome showing phenotypic diversity.
25659500 2015 Expression pattern and function of Notch2 in different subtypes of first trimester cytotrophoblast.
25574842 2015 NOTCH pathway inactivation promotes bladder cancer progression.
25558064 2015 Notch2 is required for inflammatory cytokine-driven goblet cell metaplasia in the lung.
25491639 2014 Hajdu-Cheney syndrome: a review.
25397403 2014 Notch2 controls prolactin and insulin-like growth factor binding protein-1 expression in decidualizing human stromal cells of early pregnancy.
25381598 2014 MicroRNA expression profiling and Notch1 and Notch2 expression in minimal deviation adenocarcinoma of uterine cervix.
25381127 2015 The NOTCH pathway is recurrently mutated in diffuse large B-cell lymphoma associated with hepatitis C virus infection.
25368376 2014 NOTCH-Mediated Maintenance and Expansion of Human Bone Marrow Stromal/Stem Cells: A Technology Designed for Orthopedic Regenerative Medicine.
25338527 2015 Interference of Notch 2 inhibits the progression of gliomas and induces cell apoptosis by induction of the cell cycle at the G0/G1 phase.
25323114 2014 Short hairpin RNA targeting Notch2 inhibits U87 human glioma cell proliferation by inducing cell cycle arrest and apoptosis in vitro and in vivo.
25314575 2014 The truncate mutation of Notch2 enhances cell proliferation through activating the NF-?B signal pathway in the diffuse large B-cell lymphomas.
25311243 2015 A microRNA-mediated regulatory loop modulates NOTCH and MYC oncogenic signals in B- and T-cell malignancies.
25257302 2014 Notch signaling drives multiple myeloma induced osteoclastogenesis.
25141821 2014 Recurrent mutations of NOTCH genes in follicular lymphoma identify a distinctive subset of tumours.
25041344 2015 Clinical role of Notch signaling pathway in intraductal papillary mucinous neoplasm of the pancreas.
25038880 2014 Notch2 activation is protective against anticancer effects of zerumbone in human breast cancer cells.
24995648 2014 Prenatal and postnatal findings in serpentine fibula polycystic kidney syndrome and a review of the NOTCH2 spectrum disorders.
24671051 2014 ALDH maintains the stemness of lung adenoma stem cells by suppressing the Notch/CDK2/CCNE pathway.
24574459 2014 NOTCH2 and FLT3 gene mis-splicings are common events in patients with acute myeloid leukemia (AML): new potential targets in AML.
24489102 2014 Involvement of Notch in activation and effector functions of ?? T cells.
24336671 2014 Expression of notch family proteins in placentas from patients with early-onset severe preeclampsia.
24151014 2014 Abnormal expression pattern of Notch receptors, ligands, and downstream effectors in the dorsolateral prefrontal cortex and amygdala of suicidal victims.
24122995 2013 NOTCH knockdown affects the proliferation and mTOR signaling of leukemia cells.
23999936 2013 Novel MIR143-NOTCH fusions in benign and malignant glomus tumors.
23967108 2013 Genetic susceptible locus in NOTCH2 interacts with arsenic in drinking water on risk of type 2 diabetes.
23965337 2013 A receptor-specific function for Notch2 in mediating vascular smooth muscle cell growth arrest through cyclin-dependent kinase inhibitor 1B.
23752887 2013 Renal involvement and the role of Notch signalling in Alagille syndrome.
23589286 2013 Inflammatory cytokines induce NOTCH signaling in nucleus pulposus cells: implications in intervertebral disc degeneration.
23587900 2013 notch2, notch4 gene polymorphisms in psoriasis vulgaris.
23549787 2013 Netrin-1-induced activation of Notch signaling mediates glioblastoma cell invasion.
23536545 2013 Characteristics of Notch2(+) pancreatic cancer stem-like cells and the relationship with centroacinar cells.
23444212 2013 Notch pathway activity identifies cells with cancer stem cell-like properties and correlates with worse survival in lung adenocarcinoma.
23401378 2013 Clinical consequences in truncating mutations in exon 34 of NOTCH2: report of six patients with Hajdu-Cheney syndrome and a patient with serpentine fibula polycystic kidney syndrome.
23389697 2013 Mutations in NOTCH2 in patients with Hajdu-Cheney syndrome.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23380742 2013 Notch controls generation and function of human effector CD8+ T cells.
23349727 2013 The different role of Notch1 and Notch2 in astrocytic gliomas.
23331119 Roles of myofibroblasts and notch and hedgehog signaling pathways in the formation of intrahepatic bile duct lesions in polycystic kidney rats.
23326131 2012 Notch2 regulates matrix metallopeptidase 9 via PI3K/AKT signaling in human gastric carcinoma cell MKN-45.
23243020 2013 Midkine promotes neuroblastoma through Notch2 signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23011796 2012 Direct observation of proteolytic cleavage at the S2 site upon forced unfolding of the Notch negative regulatory region.
22970250 2012 Expression profiling of stem cell-related genes in neoadjuvant-treated gastric cancer: a NOTCH2, GSK3B and ?-catenin gene signature predicts survival.
22915591 2012 Characterization of CSL (CBF-1, Su(H), Lag-1) mutants reveals differences in signaling mediated by Notch1 and Notch2.
22891276 2012 Whole-genome sequencing identifies recurrent somatic NOTCH2 mutations in splenic marginal zone lymphoma.
22891273 2012 The coding genome of splenic marginal zone lymphoma: activation of NOTCH2 and other pathways regulating marginal zone development.
22717580 2012 Constitutive Notch2 signaling in neural stem cells promotes tumorigenic features and astroglial lineage entry.
22695918 2012 Notch2 and immune function.
22526456 2012 Profiling immunohistochemical expression of NOTCH1-3, JAGGED1, cMET, and phospho-MAPK in 100 carcinomas of unknown primary.
22209762 2012 NOTCH2 mutations in Alagille syndrome.
22190591 2012 Upregulation of notch2 and six1 is associated with progression of early-stage lung adenocarcinoma and a more aggressive phenotype at advanced stages.
22161246 2012 Post-transcriptional silencing of Notch2 mRNA in chronic lymphocytic [corrected] leukemic cells of B-CLL patients.
22006338 2011 Loss-of-function mutations in Notch receptors in cutaneous and lung squamous cell carcinoma.
21976141 2012 Notch2-induced COX-2 expression enhancing gastric cancer progression.
21793104 2011 Serpentine fibula-polycystic kidney syndrome caused by truncating mutations in NOTCH2.
21726900 2011 Expression patterns of Notch receptors and their ligands Jagged and Delta in human placenta.
21681853 2011 Mutations in NOTCH2 in families with Hajdu-Cheney syndrome.
21639801 Activated NOTCH2 is overexpressed in hepatoblastomas: an immunohistochemical study.
21471519 Expression of Notch1 to -4 and their ligands in renal cell carcinoma: a tissue microarray study.
21466361 2011 Differential Notch1 and Notch2 expression and frequent activation of Notch signaling in gastric cancers.
21443520 2011 Silencing of hHS6ST2 inhibits progression of pancreatic cancer through inhibition of Notch signalling.
21437251 2011 The Notch-2 gene is regulated by Wnt signaling in cultured colorectal cancer cells.
21378989 2011 Truncating mutations in the last exon of NOTCH2 cause a rare skeletal disorder with osteoporosis.
21378985 2011 Mutations in NOTCH2 cause Hajdu-Cheney syndrome, a disorder of severe and progressive bone loss.
21238798 2011 Immunohistochemical expression of Notch signaling in the lining epithelium of periapical cysts.
21124806 2010 Notch and MAML-1 complexation do not detectably alter the DNA binding specificity of the transcription factor CSL.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20829885 2011 The Notch2-Jagged1 interaction mediates stem cell factor signaling in erythropoiesis.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20643108 2010 Inflammation dysregulates Notch signaling in endothelial cells: implication of Notch2 and Notch4 to endothelial dysfunction.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20482849 2010 NOTCH2 in breast cancer: association of SNP rs11249433 with gene expression in ER-positive breast tumors without TP53 mutations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351182 2010 Notch2 signaling is required for potent antitumor immunity in vivo.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20069356 2010 A switch in Notch gene expression parallels stem cell to endothelial transition in infantile hemangioma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20011512 2009 Notch2 signaling sensitizes endothelial cells to apoptosis by negatively regulating the key protective molecule survivin.
19946888 2010 Defining the membrane proteome of NK cells.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19862325 2009 PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 are associated with type 2 diabetes in a Chinese population.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19741467 2009 Association of common type 2 diabetes risk gene variants and posttransplantation diabetes mellitus in renal allograft recipients in Korea.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19701457 2009 Effects of S1 cleavage on the structure, surface export, and signaling activity of human Notch1 and Notch2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19670153 2010 Lack of significant effects of the type 2 diabetes susceptibility loci JAZF1, CDC123/CAMK1D, NOTCH2, ADAMTS9, THADA, and TSPAN8/LGR5 on diabetes and quantitative metabolic traits.
19653042 2009 Notch2 expression is decreased in colorectal cancer and related to tumor differentiation status.
19603167 2010 Aberrant expression of Notch signaling molecules in patients with immune thrombocytopenic purpura.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19502414 2009 Association of 18 confirmed susceptibility loci for type 2 diabetes with indices of insulin release, proinsulin conversion, and insulin sensitivity in 5,327 nondiabetic Finnish men.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19445024 2009 Gain-of-function mutations and copy number increases of Notch2 in diffuse large B-cell lymphoma.
19404845 2009 Expression and clinical significance of Notch receptors in human renal cell carcinoma.
19339697 2009 Notch1, Notch2, and Epstein-Barr virus-encoded nuclear antigen 2 signaling differentially affects proliferation and survival of Epstein-Barr virus-infected B cells.
19330030 2009 A multistage genome-wide association study in breast cancer identifies two new risk alleles at 1p11.2 and 14q24.1 (RAD51L1).
19324937 2009 Previously associated type 2 diabetes variants may interact with physical activity to modify the risk of impaired glucose regulation and type 2 diabetes: a study of 16,003 Swedish adults.
19276344 2009 Acquisition of epithelial-mesenchymal transition phenotype of gemcitabine-resistant pancreatic cancer cells is linked with activation of the notch signaling pathway.
19247373 2009 Testing the association of novel meta-analysis-derived diabetes risk genes with type II diabetes and related metabolic traits in Asian Indian Sikhs.
19147558 2009 Tenascin-C is a novel RBPJkappa-induced target gene for Notch signaling in gliomas.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19119320 2009 NOTCH2 is neither rearranged nor mutated in t(1;19) positive oligodendrogliomas.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
19020324 2008 Clinical risk factors, DNA variants, and the development of type 2 diabetes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
18714373 2008 Novel meta-analysis-derived type 2 diabetes risk loci do not determine prediabetic phenotypes.
18703315 2008 Immunohistochemical profiling of Wnt, NF-kappaB, Stat3 and Notch signaling in human epidermal tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18591388 2008 Assessing the combined impact of 18 common genetic variants of modest effect sizes on type 2 diabetes risk.
18567820 2008 Association testing of novel type 2 diabetes risk alleles in the JAZF1, CDC123/CAMK1D, TSPAN8, THADA, ADAMTS9, and NOTCH2 loci with insulin release, insulin sensitivity, and obesity in a population-based sample of 4,516 glucose-tolerant middle-aged Danes.
18508802 2008 NOTCH2 mutations in marginal zone lymphoma.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
18311147 2008 The Notch pathway in podocytes plays a role in the development of glomerular disease.
18299578 2008 Interaction with factor inhibiting HIF-1 defines an additional mode of cross-coupling between the Notch and hypoxia signaling pathways.
18266235 2008 Absence of NOTCH2 and Hey2 mutations in a familial Alagille syndrome case with a novel frameshift mutation in JAG1.
18239137 2008 Hairy-related transcription factors inhibit Notch-induced smooth muscle alpha-actin expression by interfering with Notch intracellular domain/CBF-1 complex interaction with the CBF-1-binding site.
18184405 2007 Mutational analysis of NOTCH1, 2, 3 and 4 genes in common solid cancers and acute leukemias.
18087195 2007 Associations between Notch-2, Akt-1 and HER2/neu expression in invasive human breast cancer: a tissue microarray immunophenotypic analysis on 98 patients.
17920003 2008 Deregulated expression of Notch receptors in human hepatocellular carcinoma.
17675579 2007 Notch2 signaling induces apoptosis and inhibits human MDA-MB-231 xenograft growth.
17652726 2007 A role for notch signaling in human corneal epithelial cell differentiation and proliferation.
17593975 2007 Loss of NOTCH2 positively predicts survival in subgroups of human glial brain tumors.
17573339 2007 Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor.
17401372 2007 Structural basis for autoinhibition of Notch.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16899352 2006 Analysis of coding-polymorphisms in NOTCH-related genes reveals NUMBL poly-glutamine repeat to be associated with schizophrenia in Brazilian and Danish subjects.
16773578 2006 NOTCH2 mutations cause Alagille syndrome, a heterogeneous disorder of the notch signaling pathway.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
15976178 2005 Dose-dependent effects of the Notch ligand Delta1 on ex vivo differentiation and in vivo marrow repopulating ability of cord blood cells.
15621797 2005 Regulation of CD23 expression by Notch2 in B-cell chronic lymphocytic leukemia.
15565166 2005 Induction of apoptosis by proteasome inhibitors in B-CLL cells is associated with downregulation of CD23 and inactivation of Notch2.
15507668 2004 Constitutive expression of the AP-1 transcription factors c-jun, junD, junB, and c-fos and the marginal zone B-cell transcription factor Notch2 in splenic marginal zone lymphoma.
15492845 2004 The possible correlation of Notch-1 and Notch-2 with clinical outcome and tumour clinicopathological parameters in human breast cancer.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14726396 2004 Jagged1-induced Notch signaling drives proliferation of multiple myeloma cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14609630 2003 The Tat protein of the human immunodeficiency virus type 1 (HIV-1) interacts with the EGF-like repeats of the Notch proteins and the EGF precursor.
14567914 2003 F3/contactin acts as a functional ligand for Notch during oligodendrocyte maturation.
12931033 2003 The Tat protein of the caprine arthritis encephalitis virus interacts with the Notch2 EGF-like repeats and the epithelin/granulin precursor.
12794074 2003 Phosphorylation by glycogen synthase kinase-3 beta down-regulates Notch activity, a link for Notch and Wnt pathways.
12760378 2003 Expression of Wnt and Notch pathway genes in a pluripotent human embryonal carcinoma cell line and embryonic stem cell.
12531696 2003 Notch2 protein distribution in human teeth under normal and pathological conditions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370315 2002 Identification of a family of mastermind-like transcriptional coactivators for mammalian notch receptors.
11978185 2002 Notch signalling is linked to epidermal cell differentiation level in basal cell carcinoma, psoriasis and wound healing.
11836628 2002 Differential expression of Notch genes in human osteoblastic cells.
11823422 2002 Integrity of intracellular domain of Notch ligand is indispensable for cleavage required for release of the Notch2 intracellular domain.
11577080 2001 Phosphorylation of Ser2078 modulates the Notch2 function in 32D cell differentiation.
11532344 2001 Notch receptors and hematopoiesis.
11518718 2001 Murine notch homologs (N1-4) undergo presenilin-dependent proteolysis.
11346656 2001 Manic fringe and lunatic fringe modify different sites of the Notch2 extracellular region, resulting in different signaling modulation.
11306509 2001 Notch signaling induces cell cycle arrest in small cell lung cancer cells.
11101851 2000 MAML1, a human homologue of Drosophila mastermind, is a transcriptional co-activator for NOTCH receptors.
10958687 2000 Binding of Delta1, Jagged1, and Jagged2 to Notch2 rapidly induces cleavage, nuclear translocation, and hyperphosphorylation of Notch2.
10551863 1999 Mouse jagged1 physically interacts with notch2 and other notch receptors. Assessment by quantitative methods.
10221902 1999 Notch signaling: cell fate control and signal integration in development.
10079256 1999 Human ligands of the Notch receptor.
9720489 1998 Notch is expressed in adult brain, is coexpressed with presenilin-1, and is altered in Alzheimer disease.
9528802 1998 Notch1 and Notch2 inhibit myeloid differentiation in response to different cytokines.
9244302 1997 Intracellular cleavage of Notch leads to a heterodimeric receptor on the plasma membrane.
9032325 1997 Epstein-Barr virus immortalization: Notch2 interacts with CBF1 and blocks differentiation.
8661110 1996 Paralogy mapping: identification of a region in the human MHC triplicated onto human chromosomes 1 and 9 allows the prediction and isolation of novel PBX and NOTCH loci.
7698746 1994 The human NOTCH1, 2, and 3 genes are located at chromosome positions 9q34, 1p13-p11, and 19p13.2-p13.1 in regions of neoplasia-associated translocation.
1303260 1992 Human homologs of a Drosophila Enhancer of split gene product define a novel family of nuclear proteins.