Property Summary

NCBI Gene PubMed Count 904
PubMed Score 11093.28
PubTator Score 1380.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Immune system cancer 38 0.0 1.0
Lymphoid leukemia 69 0.0 1.0
Disease Target Count Z-score Confidence
Head and neck squamous cell carcinoma 12 0.0 5.0

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.500 5.4e-06
astrocytic glioma 1.700 6.7e-03
ependymoma 2.200 1.4e-02
oligodendroglioma 2.500 3.4e-03
primitive neuroectodermal tumor 1.200 2.0e-02
intraductal papillary-mucinous adenoma (... -1.600 1.7e-05
pediatric high grade glioma 1.500 1.2e-03
group 4 medulloblastoma -1.700 1.7e-05
pilocytic astrocytoma 1.300 1.2e-05
lung carcinoma -1.300 9.0e-14
gastric carcinoma 1.300 2.9e-02

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
434982 screening 61 / 0 / 15299 Cell-based luminescence-based Maybridge primary high throughput screening assay to identify agonists of NOTCH
434983 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of NOTCH

Gene RIF (837)

PMID Text
27117272 Inhibition of WNT signaling by the PORCN inhibitor WNT974 reduced metastatic spread of UM-SCC cells, especially in UM-SCCs with Notch1 deficiency.
27048872 GATA3-mediated positive and negative feedback mechanisms via restraining Notch1 activity control human T-cell lineage commitment.
26967479 Targeting NOTCH1 signaling, suppresses melanoma tumor growth.
26943148 Notch signaling appears to play an important role in human meibomian gland epithelial differentiation and oil production.
26921446 Jagged1 fragments exert disparate effects on PC3 prostate cancer cell behaviour and Notch signaling.
26870802 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling
26837467 Autophagy impacts stem cell differentiation by degrading Notch1.
26766164 Evidence supporting a genetic basis includes the autosomal dominance of Bicuspid aortic valve inheritance patterns, and the identification of mutations in Notch homolog 1.
26765751 preliminary test using synthetic human NOTCH1 EGF modules showed significant inhibitory effects on the proliferation and adhesiveness of human breast cancer cell line MCF-7 and lung adenocarcinoma epithelial cell line A549
26759717 Data suggest that FAM84B protein and the NOTCH pathway are involved in the progression of esophageal squamous cell carcinoma (ESCC) and may be potential diagnostic targets for ESCC susceptibility.
26744411 The effects of ADAM17 inhibition on the cancer stem cells phenotype and chemosensitivity to 5-fluorouracil (5-FU) in colorectal cancer cells were examined. siRNA knockdown and TAPI-2 decreased the protein levels of cleaved Notch1
26742429 conclude that miR-935 inhibits gastric carcinoma cell proliferation, migration and invasion by targeting Notch1.
26716415 High Notch1 expression is associated with neoplasms.
26670666 Findings of frequent mutations in CDKN2A, NOTCH1, PIK3CA, and EGFR (all in excess of 20%) point to potential therapeutic avenues. Trials of targeted therapies directed toward these mutations should be explored.
26648098 TF3 suppressed the cleavage of Notch-1, subsequently decreased the expression of c-Myc, HIF-1a and VEGF, and finally the impaired cancer cells induced angiogenesis
26646450 findings provide evidence for a novel cell-autonomous pro-inflammatory Jagged1-Notch1 pathway in endothelial cells
26599017 Notch 1, pAkt and Bcl-2 proteins have roles in radioresistance of tumor cells
26592459 Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways.
26552708 Data suggest that reduction of endothelial NOTCH1 receptor is a predisposing factor in the onset of vascular inflammation and initiation of atherosclerosis.
26547035 Data indicate that NOTCH1 receptor intracellular domain (NOTCH1-IC) physically interacts with serine-threonine-protein kinase PAK 1 (PAK1) in intact cells.
26530164 The expression of cytoplasmic Notch1 or nuclear Notch4 could also be upregulated by HBx in HepG2X cells. The upregulation of Notch1 by HBx was through p38 MAPK pathway.
26522984 Targeting the NOTCH1-ZMIZ1 interaction might combat leukemic growth.
26522918 Endocytosis of Notch1 may provide a force on the ligand:receptor complex that is important for potent signal transduction.
26518891 Authors review how NOTCH1 and p16 contribute in head and neck cancer development and how microRNAs quantitatively control their expression. [Review]
26503358 knockdown of Cav-1 was also able to significantly downregulate the protein expression level of Notch-1, p-Akt and p-NF-kappaB p65 in cisplatin-resistant ovarian cancer cells.
26496776 The role of CSL-dependent and independent Notch signaling pathways in cell apoptosis is described in normal tissue homeostasis and in tumorigenesis. (Review)
26491050 Notch inhibition during the acute inflammatory response phase post-myocardial infarction is associated with macrophage-dependent pathway preventing the process of sympathetic hyperinnervation.
26471266 DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway.
26469969 Notch1 is key driver for TRAIL resistance.
26464664 These results suggested that the upregulation of notch1 and KRT6B might be involved in the development, progression and prognosis of human renal cell carcinoma
26460922 Notch1 over-expression indicated aggressive biological behaviors
26426381 NOTCH1, TP53, and MAP2K1 mutations in splenic diffuse red pulp small B-cell lymphoma are associated with progressive disease.
26416455 Thymoquinone inhibits hepatocellular carcinoma cell growth by inducing cell cycle arrest and apoptosis, achieving these effects by repression of the Notch signaling pathway.
26406415 High Notch1 expression is associated with colorectal cancer.
26398771 Notch1 expression is increased in human LSCC and correlates with tumorigenesis and metastasis, while in HEp-2 cells, Notch1 knockdown inhibited cell growth, induced apoptosis and inhibited migration and invasion by regulating Notch1 target genes.
26398566 The status of Notch1 is useful for predicting the prognosis of patients with early stage hepatocellular carcinoma undergoing hepatectomy.
26394830 NOTCH1 expression is a detrimental prognostic factor in metastatic colorectal cancer patients treated with chemotherapy plus bevacizumab
26361419 Down-regulation of Notch1 by gamma-secretase inhibitors or siRNA combined with IL-24 can sensitize apoptosis and decrease the invasion and migration capabilities of HepG2 cells.
26341090 High Notch1 expression is associated with Prostatic Intraepithelial Neoplasia.
26330272 a neighbor of NOTCH1, Lnc-RP11-611D20.2 (named NALT) which could regulate the NOTCH1 signal pathway through cis-regulation, was identified.
26307032 Aberrant expression of Notch1 plays an important role in the development of adenomyosis.
26302069 Downregulation of miR-200c is associated with overexpression of Jagged1, concomitant to Notch1 activation
26299922 MiR-139-5p not only attenuated the development of breast cancer cells but also mediated drug-resistance by regulating the expression of the downstream target gene Notch1.
26294213 In clinical specimens of various human cancers, there was a consistent pattern of NOTCH1 expression that correlated with invasive character.
26281688 It is involved in tumor initiation, cancer stem cell maintenance and angiogenesis.
26235278 Data show that notch pathway is activated in ovarian cancer specimens and correlates with chemokine receptor CXCR4/chemokine CXCL12 (SDF1alpha) expression and high proliferation levels.
26206887 Notch1-mediated inflammation and fibrogenic responses in podocytes may contribute to Fabry nephropathy.
26176534 IL-1beta and IL-1R1 promote cancer growth and metastasis by up-regulating CXCR4 expression and that CXCR4 may be a link between inflammation and cancer.
26165719 A functional polymorphism in the premiR146a gene influences the prognosis of glioblastoma multiforme by interfering with the balance between Notch1 and Notch2
26165233 NOTCH1 mutations are associated with low CD20 levels in chronic lymphocytic leukemia and are responsible for a dysregulation of HDAC-mediated epigenetic repression of CD20 expression
26164125 We speculate that synergistic heterozygosity for mutations in different NOTCH1 signaling protein genes could underlie other cases of hypoplastic left heart syndrome.
26161746 IRF6 acts as a positive regulator of proliferation and transformation in MCF10A cells downstream of Notch signaling.
26152787 patients with metastatic CRC that harbor a gain in NOTCH1 gene copy number have worse survival and that targeting this patient population with a Notch1 antibody may yield improved outcomes.
26121683 Expression of Notch1 Correlates with Breast Cancer Progression and Prognosis.
26070613 The detection of Notch1 and Delta-like 4 expression in peripheral blood lymphocytes of renal transplant recipients can serve as a positive indicator for evaluating the diagnosis and treatment efficacy of the AR reaction.
26062426 IL-23 could promote migration of human ESCC cells by activating DLL4/Notch1 signaling pathway
26045779 suggest that signaling pathways mediated by Notch1-Hes may contribute to ligament ossification of hip joints in ankylosing spontylitis patients.
26041884 Notch signaling sustains chronic lymphocytic leukemia cell survival by promoting Mcl-1 expression and eIF4E activity, and given the oncogenic role of these factors, underscores the therapeutic potential of Notch inhibition in chronic lymphocytic leukemia.
26033683 In MCF-7 cells p53 associates with the Notch transcriptional complex (NTC) in a MAML1-dependent fashion, most likely through a p53-MAML1 interaction.
26023825 Nuclear magnetic resonance (NMR) studies of human Notch1 reveal that the transmembrane domain is largely alpha-helical. The flanking juxtamembrane segments interact with the membrane surface but do not adopt a regular secondary structure.
26023825 Data suggest that transmembrane domain of NOTCH1 is largely alpha-helical; while flanking juxtamembrane segments do not adopt regular secondary structure, they interact with membrane surface.
26014475 altered Notch signaling via methylation of DLL1 is likely involved in possible disease-related mechanisms of early onset preeclampsia
25990317 Notch-1 knockdown suppresses the growth and migration of salivary adenoid cystic carcinoma (SACC) cells in vitro and the metastasis of SACC cells in vivo.
25979380 Notch1 pathway in adrenocortical carcinomas: correlations with clinical outcome
25963903 miR-9 expression was decreased in MDA-MB-231 breast cancer cells compared with MCF-10A normal breast cell line. However, NOTCH1 was upregulated in the metastatic breast cancer cells.
25963545 Data indicate that NOTCH1-related Adams-Oliver syndrome (AOS) arises through dysregulation of the Notch signaling pathway.
25920606 Interference with Notch1 increased the expression level of Hes-1.
25914224 Data demonstrate that constitutively active Notch-1 can induce epithelial-mesenchymal transition and stemness markers through a pathway that likely involves multiple Notch receptors.
25903338 Transient expression of the human cytomegalovirus tegument proteins of pp71 and UL26 reduced NICD1 and Jag1 protein levels endogenously and exogenously.
25895060 Notch1 and ATM activation are inversely correlated in human breast cancers, and inactivation of ATM by Notch1 contributes to the survival of Notch1-driven leukemia cells upon DNA damage.
25887885 Data show that the growth suppressive effect of xanthohumol (XN) in pancreatic cancer cells is mainly mediated by Notch1 receptor reduction.
25879451 Data indicate a rationale for utilization of dual Notch1 receptor and proteasome inhibition to treat T-cell lymphoproliferative neoplasms (T-LPN).
25871831 Altering NOTCH1 levels affected MGP mRNA and protein.
25869878 Patients with coexpression of both receptors might benefit from cotargeting Notch-1 and c-Met.
25849484 High Notch1 expression is associated with chronic myeloid leukemia.
25846406 Notch 3 and 4, and not Notch 1, were highly increased in human arteriovenous malformations.
25845347 The Notch signaling pathway was found to be one of the signaling pathways that inhibit OSM-induced MC3T3-E1 cell proliferation and differentiation.
25842263 The present data proved the over-expression of Notch1/JAGD1 and its association with tumor progression in human cervical cancer.
25825216 Vehicular exhaust particles activate an AhR-Jag1-Notch1 cascade to promote allergic airway inflammation in concert with proasthmatic alleles.
25802929 High concentration of folic acid and 5-methyltetrahydrofolic acid induce HT29 cell proliferation activating Notch1 pathway.
25796442 Data demonstrate that the activation of both the Notch and AR signalling pathways is involved in PLCepsilon-mediated oncogenic effects in PCa.
25786252 IGF1R may play an important role in CLL biology, in particular in aggressive CLL clones characterized by IGHV-UM, trisomy 12 and NOTCH1 mutation
25786100 Migration of smooth muscle cells from the arterial anastomosis of arteriovenous fistulas requires Notch1 activation to form neointima.
25783790 suggesting that miR-34a/Notch1 play an important role in regulating breast cancer stem cells
25768904 NOTCH1 haploinsufficiency altered H3K27ac at NOTCH1-bound enhancers, dysregulating downstream transcription of more than 1,000 genes involved in osteogenesis, inflammation, and oxidative stress.
25759215 LOXL2 is a direct repressor of NOTCH1. There is an exclusive expression pattern between LOXL2 and members of the canonical NOTCH1 pathway in human head and neck squamous cell carcinoma.
25747658 Data show how E3 ubiquitin protein ligase Mind bomb protein recognizes notch receptor ligands.
25744722 Inhibition of Notch causes pathologic activation of liver stromal cells, promoting angiogenesis and growth of hepatic metastases.
25744398 Combining detection of plasma Notch1 and TACE may be reliable for identifying the presence of abdominal aortic aneurysms
25723053 Human papillomavirus 16 E6 (16E6) interacts with the cellular protein NFX1-123, and they collaboratively increase the growth and differentiation master regulator, Notch1.
25704190 this study verified that both Notch-1 and EGFR involved in glioblastoma multiforme (GBM) tumorigenesis and may provide important information for GBM clinical treatment and prognosis
25700162 Activation of the NOTCH1 or 3 pathways has a major influence on airway basal cell differentiation into secretory and ciliated cells.
25667444 GLI1, NOTCH1 and CTNNB1 expression were assayed in a tissue microarray of 68 TET and eight benign thymus by fluorescent immunohistochemistry (AQUA) as surrogates for activity of the sonic hedgehog, NOTCH and WNT pathways
25667199 Data suggest that, in trophoblast cells, EGFL7 (epidermal growth factor-like domains protein 7) regulates cell migration and invasion/placentation by activating multiple signaling pathways via MAPK, PI3K (phosphatidylinositol 3-kinase), and NOTCH1.
25665548 It is a potential target and/or biomarker for antiangiogenic treatments.
25653136 Notch1 in the largely inactivated phenotype is inversely associated with clinical stage progression in non-small cell lung cancer
25645984 High Notch1 expression was significantly associated with high Slug, Snail, and N-cadherin expression and low E-cadherin expression in infiltrating ductal carcinoma.
25645291 Notch1 signaling regulates the epithelial-mesenchymal transition and invasion of breast cancer in a Slug-dependent manner.
25637217 Notch-1 activation increases the expression of matrix metalloprote inase-2 (MMP-2) and matrix metalloprote inase-9 (MMP-9), which increases tumor cell invasiveness.
25633905 Frameshift deletions associated with chromosomal abnormalities including trisomy 12 or 13q deletion were detected by gene sequencing in the NOTCH1 PEST domain in 3 naive CLL patients. They constitutively activate the NF-kappaB signaling pathway.
25633867 NOTCH1 mutation is associated with Head and Neck Squamous Cell Carcinoma.
25623554 A synergistic role for TGFbeta and notch pathways in a notch-dependent mesenchymal phenotype in endothelial cells, is reported.
25611897 High expression of Notch1 intracellular domain in the primary tumor of women with ovarian cancer is an independently poor prognostic factor for overall survival.
25608512 KSR1 is coordinately regulated with Notch signaling and oxidative phosphorylation in papillary thyroid cancer.
25605254 NOTCH1 mutations are associated with chronic lymphocytic leukemia.
25587027 Data suggest that ATMmutated, NOTCH1mutated and surprisingly, also a subset of TP53mutated B-CLL patients might benefit from therapeutic combinations including small molecule activator of the p53 pathway
25574842 results indicate that NOTCH serves as a tumor suppressor in the bladder and that loss of this pathway promotes mesenchymal and invasive features.
25544568 Notch1 promotes epithelial-mesenchymal transition and the cancer stem cell phenotype through induction of STAT3.
25517959 Notch1 intracellular domain immunohistochemistry appears to be a useful method in distinguishing T-lymphoblastic lymphoma from thymoma.
25512468 Data indicate that RBPJ protein depletion induces Notch target genes in a Notch-independent fashion.
25493453 NOTCH1/FBXW7 mutations are present in T-ALL patients from Southern India and may be useful biomarkers to predict prognosis in T-ALL.
25479589 The inhibitory effect of Notch-1 on CREB is dependent upon N1 gamma-secretase cleavage, and release of the ICD from the membrane bound receptor.
25456735 Our results demonstrate that activation of Notch1 signaling pathway may represent a new strategy for treating human SCLC
25425968 Data indicate that the inhibitory effect of galectin-3 was found to be through its binding to Notch1 protein in a sugar-dependent manner.
25425197 In chronic lymphocytic leukemia (CLL), NOTCH1 mutation is associated with Notch1-intracellular domain phosphorylation, a molecular mechanism enhancing Notch signaling and CLL cell survival.
25420528 Low expression of SIRT1 or the combined low expression of SIRT1 and high expression of N1IC could be used as indicators of poor prognosis in breast cancer.
25418282 Data suggest the involvement of the Notch signalling pathway in dendritic cells (DCs) expressing higher levels of the Notch ligands.
25406187 Notch1 mutations are drivers of oral tumorigenesis.
25400232 our results show that by complexing with a second molecular targeting therapeutic, such as Notch-1 shRNA in this report, Fe3O4@SiO2(FITC)/PEI-FA can be exploited as a novel, non-viral, and concurrent targeting delivery system for targeted gene therapy
25385755 Data indicate that cell division cycle associated 7 protein (Cdca7) is strongly up-regulated in the hemogenic population during embryonic stem cell hematopoietic differentiation in a Notch-dependent manner.
25381598 High NOTCH1 expression is associated with minimal deviation adenocarcinoma of uterine cervix.
25381127 NOTCH1 mutations were associated with diffuse large B-cell lymphoma with hepatitis C virus infection.
25380486 Data indicate the role for endothelial Jagged1 protein to promote breast tumor through notch protein activation.
25380126 Haploinsufficiency of NOTCH1 caused by either microdeletions at 9q34.3 or intragenic mutations are associated with Kleefstra syndrome.
25377784 Mutations in NOTCH1 gene is associated with recurrent convergent evolution in chronic lymphocytic leukemia.
25369933 A distal enhancer at >1 Mb 3' of human Myc binds Notch transcription complexes and physically interacts with the Myc proximal promoter. Changes in Notch activation change H3K27 acetylation across the entire enhancer correlating with Myc expression.
25368020 Ectopic miR34a expression reduced cancer stem cell properties and increased sensitivity to doxorubicin treatment by directly targeting NOTCH1
25355291 High NOTCH1 expression is associated with T acute lymphoblastic leukemia.
25344755 cyclin-C-CDK complexes phosphorylate the Notch1 intracellular domain (ICN1) and promote ICN1 degradation
25344525 NOTCH1 activating mutations are associated with T-cell acute lymphoblastic leukemia.
25337219 Notch1 expression was correlated with vasculogenic mimicry in hepatocellular carcinoma tumor cells.
25316189 Data link the let-7 miRNAs circuit to NOTCH signaling and suggest that this interaction serves to regulate developmental progression.
25311243 Intracellular NOTCH1 and NOTCH2, by inducing MYC, suppressed miR-30a in B- and T-cell malignancies.
25299773 The interplay between Dll1-activated Notch1 and Mef2C supports mesoangioblasts commitment.
25295490 Conditionally activating the Notch1 receptor and deleting p53 in the digestive epithelium leads to the development of metastatic tumours with high penetrance.
25278704 Xiaotan Sanjie decoction attenuates tumor angiogenesis, at least partially, by inhibiting Notch-1.
25263445 Results indicate that notch1 receptor NOTCH1-activated cells are more susceptible to inhibition of SUMOylation.
25257945 The role of Notch1 signaling in modulating epithelial to mesenchymal transition in colorectal adenocarcinoma.
25254944 Stimulation with sphingosine-1-phosphate enhances cancer stem cells via S1PR3 and subsequent Notch1 activation.
25253780 our study identifies coordinate hyperactivation of Notch1 and Ras/MAPK pathways as novel biomarkers for poor breast cancer outcome.
25234595 These results suggest that NOTCH1 mutation occurs frequently in Japanese OSCC in the vicinity of the ligand binding region and, these mutations cause downregulation of the NOTCH1 function.
25213258 By inducing autophagy via the ERK/AKT-mTOR-STAT3-Notch signaling cascade.
25194570 identify a new long range-acting MYC enhancer controlled by NOTCH1 that is targeted by recurrent chromosomal duplications in T cell acute lymphoblastic leukemia
25192910 TRPM7 activates JAK2/STAT3 and/or Notch signaling pathways and leads to increased cell proliferation and migration.
25179844 MicroRNA-449a reduces cell survival and enhances cisplatin-induced cytotoxicity via downregulation of NOTCH1 in ovarian cancer cells.
25176314 our results suggest that the JAG1/Notch1/OPN cascade represents a potential therapeutic target for hepatocellular carcinoma metastasis.
25149541 Overexpression of NOTCH1 in SACC cells promoted cell growth, migration and invasion, and knockdown of NOTCH1 inhibited cell proliferation in vitro and tumorigenicity in vivo by inducing cell apoptosis.
25149074 Data show that autocrine motility factor receptor (AMFR) and NOTCH1 protein are the direct target genes of microRNA miR-139-5p in colorectal cancer (CRC).
25141821 NOTCH1 and NOTCH2 mutations are uncommon in Follicular lymphoma but may occur in a subset of cases with distinctive, characteristic, clinicopathological features.
25132448 Mutations in NOTCH1 cause Adams-Oliver syndrome.
25120811 This is the first study to suggest an increased risk of invasive ductal carcinoma and ductal carcinoma in situ of the breast for the Notch1 rs3124591 variant.
25110169 The knockdown of Notch1 in both hepatocellular carcinoma cell lines increased both the total expression of PTEN and its phosphorylated form but FAK and phospho-FAK expression was decreased following Notch1 depletion.
25109409 NOTCH1 knockdown in bladder cancer cells led to higher KLF4 expression, decreased cell growth and proliferation, and increased apoptosis and G0/G1 arrest.
25107841 Notch1 signalling in hepatocytes was inhibited following downregulation of Pofut1 expression.
25083870 Study identified many previosly unreported human T cell acute lymphoblastic leukemia-specific long noncoding RNAs that are key downstream targets of oncogenic Notch1.
25073953 A role of Notch1 signaling in activation of Cyclin D1-mediated cell proliferation in colon cancer.
25050861 Combined expression of NKX2-5, HAND1, and NOTCH1 coordinately contribute to cardiac malformations in Hhypoplastic left heart syndrome.
25041344 Its signaling pathway determines pathological aggressiveness of intra ductal papillary mucinous neoplasm of the pancreas.
25034654 This study provides evidence that activated Notch1 is overexpressed in cutaneous melanoma, in tumor cells as well as in microvessel endothelium, and that it can promote tumor angiogenesis.
25031748 this study reveals that aberrant expression of Notch receptors 1 and 4 might play important roles during intrahepatic cholangiocarcinoma progression
25017705 Study showed that Notch1 may exert its effect on hepatitis B virus X protein-related hepatocellular carcinoma primarily via activation of the Wnt pathway.
25004243 Results identify a new functional role for a Notch1-Sox9 signaling axis in lung ADC that may explain the correlation of Sox9 with tumor progression, higher tumor grade, and poor lung cancer survival.
24993241 NOTCH1 and BSG mRNA levels are significantly increased in benzene exposed workers and may play a role in leukemia development.
24977325 CD24 may regulate the epithelial to mesenchymal transition and stemness through Notch1 signaling in breast cancer cell
24970818 Data indicate that depletion of nicotinamide phosphoribosyltransferase visfatin and Notch1 decreases cell proliferation and induces apoptosis.
24966950 Notch-1 and Ki-67 expression may act as promising predictors for the recurrence and prognosis of Kimura's disease.
24950189 Notch signaling regulates the lifespan of vascular endothelial cells via a p16-dependent pathway
24931169 Functional studies revealed unique interactions between Notch1 and cellular senescence checkpoint functions via (TGF)-beta signaling, which may influence dichotomous Notch1 functions in squamous carcinoma cells and other cancers.
24923451 NOTCH1 mutations occurred in 20 out of 123 CLL cases given first-line induction treatment with fludarabine followed by rituximab. NOTCH1 mutations were associated with shorter remission and shorter overall survival in these patients.
24905589 Notch-1 and Notch-3 may play an important role with synergistic effect of HPV in regulating development and proliferation of cervical cancer
24898819 Notch1-stimulated GBM cells expressed pericyte cell markers and closely associated with endothelial cells. Results reveal an important role for the Notch1 pathway in regulating GBM stem cell plasticity and angiogenic properties.
24888228 Notch1 expression has a tumor inhibitory effect on ADC cells, but not SCC cells.
24885920 miR-139-5p plays a pivotal role in colon cancer through inhibiting cell proliferation, metastasis, and promoting apoptosis and cell cycle arrest by targeting oncogenic NOTCH1
24878247 These results clearly suggest that Notch signaling regulates glycolysis under hypoxic conditions and, thus, likely affects the cell lifespan via glycolysis.
24829201 trisomy 12 CLL cells exhibit functional upregulation of integrin signaling, with beta2-integrin expression being modulated by NOTCH1 mutation status.
24803430 Notch1 binding to Notch ligands is increased by fringe-mediated extension of O-linked fucose in the ligand-binding region
24801890 Sustained Notch1 expression is one key event implicated in the arsenite human skin carcinogenic effect, also provides mechanistic insights into the molecular aspects that determine whether Notch signaling will be oncogenic or tumor suppressive.
24789803 Results reveal that Notch1 expression is a potential prognostic factor for malignant progression, metastasis, and survival of laryngeal squamous cell carcinoma patients.
24782036 NOTCH1 signaling could transactivate ABCC1, resulting in higher chemoresistance ability of PCSCs, which might be one of the important mechanisms underlying the chemoresistance of PCSCs.
24780321 Notch-1 is overexpressed in colorectal cancer tissues, particularly in advanced stages.
24768363 Notch signaling is differentially regulated in aneurysmal tissue and may play a causative role in the development of abdominal aortic aneurysms.
24755984 In mice, transfection with exogenous human Notch1 intracellular domain suppressed Sox17 expression at the vascular front during postnatal retinal angiogenesis and inversely regulates Sox17 expression mainly at the post-transcriptional level.
24743148 Experimentally increased ERbeta expression or treatment with ERbeta agonists inhibited proliferation of SCC cells and promoted NOTCH1 expression and squamous differentiation
24728738 High nuclear Notch1 expression is associated with tumor recurrence in patients with stage II and III colorectal cancer.
24727675 An aberrant microRNA signature in childhood T-cell lymphoblastic lymphoma affecting CDKN1B expression, NOTCH1 and growth factor signaling pathways.
24726647 These results indicate that Notch1 signaling in human hematopoietic stem cells promotes CD8(+) single posistive T cell development, and that T cell leukemogenesis may require additional oncogenic factors other than Notch1 activation.
24710932 Blocking Notch-1 signaling can inhibit the malignant behaviors of BCSCs, which may provide a promising therapeutical approach for breast cancer.
24700253 Silencing Notch1 can inhibit the proliferation and invasiveness of ICC cells and increase their sensitivity to 5-FU in vitro.
24695418 Hyperexpression of NOTCH-1 was seen in 7/97 acute myeloid leukemia specimens, the other patients showed some expression of NOTCH-1
24690100 NOTCH1 mutations are associated with favourable long-term prognosis in paediatric T-cell acute lymphoblastic leukaemia.
24684482 The Notch1 and ROS-induced PI3K/Akt signals cooperatively increase Snail expression and may induce malignancy in hepatocellular carcinoma(HCC).
24671051 Expression of Notch1, -2, and -3, CDK2, and CCNE1 was significantly decreased by upregulation of ALDH1A1 in A549 cells, but increased by its interruption in A549s cells.
24662767 NOTCH1 acts as a gatekeeper in human cutaneous squamous cell carcinogenesis.
24659709 Study suggests that the epigenetic silencing of miR-199b-5p during tumor progression is significantly associated with acquired chemoresistance in ovarian cancer through the activation of JAG1-Notch1 signaling.
24652989 TP53 and SF3B1 mutations appear among the strongest prognostic markers in chronic lymphocytic leukemia patients receiving current-standard first-line therapy.
24642622 Notch1 activation was correlated with gastric cancer progression and defined as a novel independent prognostic factor.
24628678 Notch1 can mediate HBx-induced epithelial-mesenchymal transdifferentiation of HK-2 cells, promote HBx-induced increases in immune molecule expression and exacerbation of cytokine disorders.
24560443 Notch-1 signaling is inactivated in vitiligo with consequent loss of epidermal and/or follicular active melanocytes.
24492617 MT1-MMP operates as a novel protease that promotes Notch1 activation in melanoma cells.
24489102 Knockdown of Notch1 and Notch2 genes in gammadelta T cells using small interfering RNA inhibited their antitumor cytotoxic potential
24474689 the Notch1 signaling pathway affects the mitochondrial proteome, which affects the functioning of key metabolic pathways
24469571 The growth and invasion rates of SGC7901 gastric cancer cells were significantly reduced after Notch1 silencing.
24453806 Notch signaling has a role in the migration and proliferation of retinal pigment epithelial cells
24446471 An increased activation of the Notch pathway may contribute to the pathogenesis of Behcet's disease.
24424791 There was no difference in overall (P = 0.14) or event-free survival (EFS) (P = 0.10) in patients with T-ALL with mutation(s) in NOTCH1/FBXW7 compared with patients with T-ALL without mutations in any of these genes.
24424521 Our findings highlight an indispensable role for Notch-1-mediated signaling in the intricate epithelial-immune crosstalk, and validate that epithelial Notch-1 is necessary and sufficient to support protective epithelial proinflammatory responses.
24423157 Notch-1 could be used as a predictable biomarker to be detected in different pathological and histological subtypes in LAD for diagnosis or prognosis.
24418111 R1279H substitution in the NOTCH1 gene is significantly overrepresented in patients with aortic coarctation and, therefore, may represent a disease-susceptibility allele.
24415757 NOTCH1 protein regulates CD80/CD86-induced phosphatidylinositol 3-kinase signaling in interleukin-6 and indoleamine 2,3-dioxygenase production by dendritic cells
24406215 CCN3 can promote dentinogenesis by coordinating proliferation and odontoblastic differentiation of dental pulp stem cells via modulating Notch and BMP2 signaling pathways.
24392017 a signalling pathway, namely the MEK/ERK pathway that positively impacts on NOTCH nuclear outcome
24336972 the blockade of Notch1 signaling was associated with the arrest of the cell cycle in the G0/G1 phase via the CyclinD1/CDK4 pathway and the promotion of apoptosis via the caspase-9-caspase-3 pathway.
24330353 Notch-1 signalling mediates downstream endothelial cell function that may contribute to the pathogenesis of psoriasis.
24326827 For the first time, we show that LRF/Pokemon is predominantly expressed in nodular lymphocyte-predominant Hodgkin lymphoma with low to absent NOTCH1 protein
24321094 In conclusion, results of our study suggest that the NOTCH-signaling pathway, which is activated during the osteogenic differentiation of DFCs.
24308033 Demonstrated oncogenic role for NOTCH1 in Chronic Myelogenous Leukemia (CML) and BCR-ABL disruption of NOTCH1-CCN3 signalling may contribute to the pathogenesis of CML.
24305720 Low Notch1 expression is associated with glioblastoma multiforme.
24281414 MiR-200b directly targets Notch1 3'UTR.
24277457 Notch1 mutation is common in Chinese oral squamous cell carcinoma and associates with clinical outcomes
24260356 AQP3-Notch1 axis may provide insight into epidermal homeostasis control.
24249312 NOTCH1 mutations are associated with T-Cell Lymphoblastic Leukemia-Lymphoma.
24217574 hazard ratio for predicting early death was 4.298 (95% confidence interval 1.515-12.195) for high versus low NOTCH1 expression
24216479 Silencing ICMT in osteosarcoma cells decreased Notch1 signaling in response to stimulation with cell-surface ligands.
24204826 Activation of Notch signaling is required for cholangiocarcinoma progression.
24177259 findings demonstrated that the presence of small NOTCH1-mutated subclones from early phases of the disease affected chronic lymphocytic leukemia outcome
24170027 NOTCH1 signals may create conditions that favor drug resistance, thus making NOTCH1 a potential molecular target in CLL
24166518 Report role of NOTCH1 oncogenetic risk classification in the prognosis of adult T-cell acute lymphoblastic leukemia.
24162774 HIV-1 gp120 upregulates the expression of notch 1 (NOTCH1) in human B cells
24151014 A reduction of NOTCH1 expression was found in the dorsolateral prefrontal cortex and amygdala of suicide victims compared to controls.
24141420 the down-regulation of Notch1 significantly sensitized colorectal cancer cells to chemotherapy and ionizing radiation.
24140581 Recurrent NOTCH1-A465T mutation is associated with brain neoplasm.
24140425 NOTCH1 gene rearrangements occur in invasive breast carcinoma.
24122995 NOTCH1 and 2 knockdown reduces the level of mechanistic target of rapamycin (mTOR) protein in the monoblastic leukemia cell line THP-1.
24113472 adverse prognostic impact on time to treatment and overall survival was observed for SF3B1mut, NOTCH1mut and TP53 disruption
24113181 A novel AKT1/NF-kappaB/Notch1/PTEN axis has an important role in the development of chemoresistance in gastric cancer.
24109236 NFX1-123 and human papillomavirus 16E6 upregulated Notch 1 expression in keratinocytes.
24108462 Data indicate that culture abrogated differential gene expression in part due to gradual loss of canonical Notch activity and HEY2 expression.
24095799 The Notch1 is not only down regulated the Shh pathway, but also inhibited recombinant Shh mediated erythropoiesis.
24024180 These data suggest that modulation of Notch1 signaling pathway by MSCs and/or NCD can be considered as a therapeutic target in HCC.
24022665 This study indicated that Notch-1 might be a useful target for esophageal carcinoma prevention and therapy.
24019071 Intracellular forms of NOTCH1 trigger the immediate activation of ROCK1 independent of its transcriptional activity, promoting differentiation and resulting in decreased clonogenicity of normal human keratinocytes.
24010734 Notch1 is expressed on a functionally distinct subpopulation of CD34(+) cells that is highly enriched for stem cell activity and multilineage potential and could suggest that Notch1 could be used as a novel stem cell marker.
23999936 A gene fusion involving MIR143 in band 5q32 was identified with NOTCH1 in 9q34 in glomus tumors
23990360 Notch activity showed stronger correlation with the nonalcoholic fatty liver disease activity score and alanine aminotransferase levels than with steatosis alone, suggesting that Notch activity is associated with nonalcoholic steatohepatitis.
23974200 Our study presents the first evidence that C/EBPalpha, miR-30c, and Notch1 together play a critical role in granulocytic differentiation
23938602 Data suggest Notch1/NICD (intracellular Notch domain) are up-regulated at invasive tumor front in oral squamous cell carcinoma; Notch1 expression correlates with pathological stage, clinical stage, invasiveness, proliferation, and perhaps metastasis.
23924630 Notch signaling is activated before p63 expression in ectodermal progenitor cells.
23916913 Data suggest that Notch-1 might play a novel role in acquired resistance of non-small cell lung cancer to EGFR inhibitor gefitinib.
23902763 rhamnetin and cirsiliol can act as promising radiosensitizers that enhance the radiotherapeutic efficacy by inhibiting radiation-induced Notch-1 signaling associated with radioresistance possibly via miR-34a-mediated pathways
23899513 Our results suggest that Notch1 is an essential downstream mediator of immortalized keratinocyte cellular proliferation via the EGF signaling pathway.
23893575 Studied incidence and biological significance of clonal evolution (CE) in chronic lymphocytic leukemia using cytogenetics and its relationship with prognostic markers such as CD38, ZAP70, and the mutational status of IGHV and NOTCH1.
23883974 The results demonstrate elevated expression of Notch1 in some metastatic tumors, suggesting that Notch1 may play an important role in the development or maintenance of metastatic lesions
23881612 These results indicate that RECK represses stemness gene expression and stem-like properties by inhibiting ADAM-mediated Notch1 shedding and activation.
23870033 Downregulation of the endothelial genes Notch1 and ephrinB2 in patients with nodular regenerative hyperplasia.
23860447 present the first deep-sequencing study of NOTCH1 mutations in a large unselected CLL cohortand report an overall mutation frequency of 12.1%.
23839946 direct measurement of the binding affinity of Notch1 EGF repeats 6-15 for Dll1 and Dll4 revealed that Dll4 binds with at least an order of magnitude higher affinity than Dll1
23821658 NOTCH1 mutations are associated with response to treatment in fludarabine refractory chronic lymphocytic leukemia.
23798201 Among patients with calcific aortic stenosis, the mutations R1279H and V2285I were detected in 18 and 14 heterozygotes, respectively. A common polymorphism (rs13290979) located in intron 2 was significantly associated with AS.
23788636 results suggest that Notch1 can regulate PP2A dephosphorylation of critical cellular regulators including AKT, AMPKalpha, and p70S6K
23787764 High NOTCH1 expression is associated with glioblastoma multiforme.
23776410 the downstream Notch signalling effector HES5 directly represses transcription of the E3 ligase Fbw7beta.
23775982 This is the first study to demonstrate that Jagged1 delivery transiently activates Notch signaling and increases osteogenesis.
23775085 Data indicate that cAMP activates Notch signaling and increases the expression of recombinant recognition sequence binding protein at the Jkappa site (RBP-J) and transducin-like enhancer of Split (TLE).
23749167 Thymosin beta4 increased Notch1 and Notch4 expression in a dose and time-dependent manner.
23743248 slug has a role in a PI3 kinase pathway that promotes endothelial survival via notch activation
23742774 Notch1 and Notch4 could be used as immunohistochemical biomarkers to detect patients with a shorter disease-specific survival.
23734977 this study emphasizes the contention that NOTCH1 mutations is a novel risk marker in chronic lymphocytic leukemi -patients
23733784 NOTCH signaling is a primary driver of T helper (Th)1 cell-mediated pathogenesis in aplastic anemia.
23713656 Data indicate that gamma-secretase inhibitors are selective for inhibition of amyloid beta generation over Notch.
23707238 Angiotensin II plays a role in glomerular injury in experimental and human diabetic nephropathy via persistent activation of Notch1 and Snail signaling in podocytes resulting in down-regulation of nephrin expression.
23688168 Notch1 may induce a migratory effect in Intrahepatic Cholangiocarcinoma by causing an epithelial-mesenchymal transition
23671619 Lung adenocarcinoma cells may enhance Notch1 activation as a protective mechanism in response to pterostilbene treatment.
23665520 Studies indicate roles of Notch in adaptive immunity in the regulation of T cell differentiation and function.
23651443 inhibition of CK2alpha down-regulates Notch1 signalling and subsequently reduces a cancer stem-like cell population in human lung cancer cells
23645351 we explored heterogeneity in expression of EGFR, VEGF and NOTCH1 in head and neck squamous cell carcinomas
23642368 miR-34a sequesters Notch1 mRNA to generate a sharp threshold response where a bimodal Notch signal specifies the choice between self-renewal and differentiation.
23640488 Elevated Notch1 levels and enhanced Notch1 activation play a major role in augmentation of the pro-osteogenic response of aortic valve interstitial cells of stenotic valves through modulation of ERK1/2 and nuclear factor-kappaB activation.
23632994 The correlation between TRB3 and Notch 1 expression revealed that Notch 1 was downregulated by the knockdown of TRB3 in the lung adenocarcinoma cell lines.
23630292 Rnd3 is a regulator of Notch1 signaling
23625115 Downregulation of Notch is associated with pathogenesis of myelo-erythroid disorders.
23620080 Short telomeres were particularly associated with high-risk genetic markers, such as NOTCH1, SF3B1, or TP53 aberrations, and predicted a short time to treatment (TTT) and overall survival (OS) (both P < 0.0001). TL was an independent prognostic factor
23605216 Notch signal activation in inflammatory cells may be involved in the pathophysiological mechanism underlying Buerger's disease.
23603912 NOTCH1 mutations are associated with early T-cell precursor acute lymphoblastic leukemia.
23594289 Stromal expression of Notch-1 may have a negative impact on disease progression, possibly through up-regulation of the active nuclear form of Oct-4 in carcinoma cells.
23589494 Hypoxia increased the levels and activity of the ADAM12 metalloprotease in a Notch signaling-dependent manner, leading to increased ectodomain shedding of the epidermal growth factor (EGF) receptor (EGFR) ligand heparin-binding EGF-like growth factor.
23589286 An increase in expression of selective NOTCH receptors (NOTCH1 and -2), ligand (JAGGED2), and target genes (HES1, HEY1, and HEY2) was observed in NP cells following cytokine treatment.
23583836 NO regulates the expression of Hey1, a downstream target of Notch1, and alters nuclear localization of Notch1 intracellular domain.
23578328 Germline mutations in NOTCH1 contribute to familial bicuspid aortic valve in Italian patients.
23576735 Blocking NOTCH signaling abrogates growth of resistant breast cancer cells.
23569274 Notch1 modulates oxidative stress induced cell death through suppression of apoptosis signal-regulating kinase 1.
23568245 Notch1 contributes to chemoresistance to gemcitabine and serves as a significant indicator of unfavorable prognosis in pancreatic ductal carcinoma.
23558524 NOTCH1 gene mutation is associated with chronic lymphocytic leukemia.
23542114 Arsenic trioxide depletes cancer stem-like cells and inhibits repopulation of neurosphere derived from glioblastoma by downregulation of Notch pathway.
23533157 ERK-dependent induction of miR-18a* directly represses expression of DLL3, an autocrine inhibitor of NOTCH, thus enhancing the level of activated NOTCH-1.
23531595 Studies indicate that NOTCH1 and SF3B1 are the most frequently mutated genes in chronic lymphocytic leukemia (CLL).
23500524 Notch1 might play a critical role in the resistance to paclitaxel, and targeting Notch1 may have important clinical applications in cancer therapy.
23468978 hypothesize that targeting Notch1 may be more useful than Notch3 for designing novel preventive and therapeutic strategies for HCC in the near future
23455394 These findings expand the role of Notch signaling in hematopoietic diseases, and further define the mechanistic events important for PML-RARA-mediated leukemogenesis.
23454378 Snail decreased transcription of Notch1 intracellular domain (NICD) target genes via competing with MAML1, co-activator, in NICD complex.
23444212 Data indicate that the expression of Notch-2 and Notch-4 receptors was higher in the GFP-bright population whereas Notch-1 and Notch-3 receptors were more expressed in GFP-dim population.
23435461 Allogeneic hematopoietic stem cell transplantation can provide long-term disease control in patients with poor-risk chronic lymphocytic leukemia independent of the presence of TP53, SF3B1, and NOTCH1 mutations.
23430952 Diallyl trisulfide inhibited osteosarcoma growth and aggressiveness via a novel mechanism targeting a Notch-miRNA regulatory circuit.
23423517 The Notch1-Hes1 signalling axis suppresses neuroendocrine differentiation and maintains tubular/acinar features in adenocarcinoma and non-neoplastic epithelium in the biliary tree.
23409141 Notch1 expression is associated with cell aggressiveness and 5-FU drug resistance in human esophageal squamous cell carcinoma cell lines in vitro and is significantly associated with a poor survival in human esophageal squamous cell carcinomas
23396245 Notch transgene signaling may promote proliferation and differentiation of reactive astrocytes through regulation of nucleo-cytoplasmic translocation of Olig2 following stroke.
23380742 These data indicate that Notch signaling controls human CD8(+) T cell priming and also influences effector T cell functions.
23349727 different role of Notch1 and Notch2 in astrocytic gliomas
23349303 NOTCH1 activation clinically antagonizes the unfavorable effect of PTEN inactivation in BFM-treated children with precursor T-cell acute lymphoblastic leukemia.
23341344 Data indicate that NOTCH1 was the most frequently mutated gene in T-cell acute lymphoblastic leukemia (T-ALL), and ANDRUNX1 and DNMT3A were frequently mutated in T-ALL and associated with poor prognosis in early T-ALL.
23339193 Data indicate that a Notch-1-specific monoclonal antibody blocks binding with Jagged-1/Serrate.
23319603 Data indicate a dominant role for TRB3 and MAPK-ERK/TGFbeta pathways as Notch regulators in breast cancer, establishing TRB3 as a potential therapeutic target.
23300864 Overexpresion of NOTCH1 in endothelial cells inhibited cell proliferation, cell migration, and sprouting angiogenesis and promoted cell adhesion to the extracellular matrix in a transcription-independent manner
23300792 Higher levels of Notch1 protein, intracellular domain and mRNA implicate pathway involvement in thoracic aortic aneurysm and dissection.
23295735 NOTCH1 mutation increased the risk of transformation to diffuse large B-cell lymphoma
23289374 Notch1 signalling is required for hypoxia/HIF-1alpha-induced proliferation, invasion and chemoresistance in T-ALL.
23252402 Although the interaction between Notch1 and MDM2 results in ubiquitination of Notch1, this does not result in degradation of Notch1, but instead leads to activation of the intracellular domain of Notch1.
23243274 Clonal evolution from lower to higher risk implicated the emergence of NOTCH1, SF3B1, and BIRC3 abnormalities in addition to TP53 and 11q22-q23 lesions in chronic lymphocytic leukemia.
23239744 The Notch/Dll4 pathway activated by VEGF initiates a novel signaling cross-talk between acute myeloid leukemia and endothelial cells and promotes angiogenesis.
23235341 Notch1/Hes1-signaling pathway is activated during early pancreatic embryogenesis and reaches the highest at birth.
23226395 miRNA-449a plays an important role in modulating expression of YKL40 through targeting the components of the NOTCH signaling pathway following hepatitis C virus infection.
23225326 Pancreatic tumors of unknown behavior and malignant insulinomas had no signs of Notch1 expression in contrast to benign insulinomas.
23179396 findings strongly suggest that high levels of Notch1 expression significantly correlate with tumor progression and an unfavorable patient prognosis
23171551 Notch signaling in mammalian systems is initiated from either the plasma membrane or lysosome, but not the early endosome.
23167503 findings showed the delCT NOTCH1 mutation occurred in 41 out of 463 of chronic lymphocytic leukaemias at diagnosis and was associated with all the investigated prognostic markers; a significantly shorter survival was found in patients carrying delCT NOTCH1 mutation compared to patients lacking the mutation
23161489 ZMIZ1 and activated NOTCH1 are coexpressed in a subset of human T-ALL patients and cell lines.
23161436 modulates mesenchymal stem cells mediated regulatory T-cell induction
23138133 NOTCH1 mutations are associated with chronic lymphocytic leukemia.
23124652 High Notch1 expression is associated with hypoxia-induced hepatocellular carcinoma cell invasion and migration.
23124208 Increased CREMalpha binding to the Notch-1 promoter resulted in significantly reduced Notch-1 promoter activity and gene transcription.
23108395 DDX5 might be critical for NOTCH1-mediated T-ALL pathogenesis and thus is a potential new target for modulating the Notch signaling in leukemia
23103515 Phosphorylated Notch1-IC by CaMKIV increases Notch1-IC stability, which enhances osteoclast differentiation.
23102684 data suggest that there are phenotypic differences that distinguish families with and without NOTCH1 mutations, indicating a genotype-phenotype correlation
23087364 Decreased levels of Notch1 protect against the formation of abdominal aortic aneurysms by preventing macrophage recruitment and attenuating the inflammatory response in the aorta.
23086478 NOTCH1, which is frequently activated by mutation in T-ALL and required for LIC activity in both mouse and human models, thus acts to repress PKC-theta
23084143 We investigated the mechanism by which Notch1 activation controls expression of FoxL2, which in turn activates smooth muscle actin gene expression in periocular mesenchyma to control eyelid levator smooth muscle formation.
23074278 JAG2-mediated Notch activation confers phenotypic and functional aspects of Langerhans cell histiocytosis to dendritic cells.
23072667 Data indicate that, although Notch1 receptor ELRS [EGF (epidermal growth factor)-like-repeats] 11-12 are the principal ligand-binding site, the ELRs 25-26 serve as a secondary binding site and play an important role in receptor activation.
23067214 Notch1 overexpression promotes cell growth and tumor angiogenesis in myeloma.
23053901 contributes to hepatocellular carcinoma cell invasion and migration by regulating Snail/E-cadherin through COX-2
23049092 Notch signaling appears to decrease in the early stages of wound healing which contributes to cytoskeletal changes with subsequent augmentation of migratory behavior.
23040356 Eight novel mutations were found in NOTCH1 and one in BCL11B gene in T-cell acute lymphoblastic leukemia pediatric patients.
23028920 Results suggest that the radiation-sensitive protein NOTCH1 can be up-regulated in lung tissue from uranium miners by level of exposure to pulmonary carcinogens.
23022380 Data indicate that identification of components of the Notch-activation complex provide insights into the molecular mechanisms that govern Notch-mediated activation of its target genes.
22986536 Demonstrate that inhibition of Notch1 by plasmid-based shRNA suppresses growth of human hepatic cells transfected with HBx through G0/G1 cell cycle arrest and apoptosis inhibition.
22972921 Absence of T cell precursor potential, both in vivo and in vitro, is due to low Notch1 expression and secondary to inhibition of E2A protein activity by members of the inhibitor of DNA binding (Id) protein family.
22968660 In contrast to other reports, Notch1 signaling was not involved in the antileukemic effect of histone deacetylase inhibitors valproic acid and suberic bishydroxamic acid in B-ALL cells.
22965987 Notch1 enhances the inflammatory response to TLR4 in human aortic valve interstitial cells by modulating NF-kappaB activation. Excessive cross-talk between the TLR4 & Notch1 pathway augments the TLR4 response in AVIC of stenotic valves.
22956186 Conditioned medium from SPARC-overexpressed neuroblastoma cells (pSPARC-CM) suppressed expression of growth factors was mediated by inhibition of the Notch signaling pathway.
22954590 Findings suggest that Mel-18 is a novel negative regulator of breast cancer stem cell (CSC) that inhibits the stem cell population and in vitro and in vivo self-renewal through the inactivation of Wnt-mediated Notch signaling.
22940701 ADAM10 promotes non-small cell lung cancer cell migration and invasion via the activation of the Notch1 signaling pathway
22929735 Preconditioning-induced protective effects against cerebral ischemia are mediated by activation of the Notch1 signaling pathway.
22922832 Notch1 activation promotes human HCC cell growth and proliferation, which may contribute to the progression of this type of malignant carcinoma.
22915591 Characterization of CSL (CBF-1, Su(H), Lag-1) mutants reveals differences in signaling mediated by Notch1 and Notch2.
22914328 NOTCH1 intracellular domain induces Akt-dependent upregulation of cytoplasmic EZH2.
22902365 NOTCH1 mutations are associated with B-cell chronic lymphocytic leukemia progression.
22877736 Our study provides unequivocal evidence that NOTCH1 plays a tumor-suppressive role during esophageal squamous cell carcinoma development.
22863622 a suppressive role of Notch1 on WNT/beta-catenin target genes involved in colorectal cancer.
22846929 Activating mutations in the NOTCH1 gene are associated with Glucocorticoid sensitivity of T-cell lymphoblastic leukemia/lymphoma.
22833359 Up-regulation of miR-210 can activate the Notch signaling pathway, which may contribute to angiogenesis after cerebral ischemia.
22814294 Activating mutations in the NOTCH1 gene are frequent in pediatric T-cell acute lymphoblastic leukemia.
22809957 Endothelial nuclear IL-33 is induced by Notch and that Dll4 may be the dominant ligand responsible for this signaling in vivo.
22781716 Notch1 overexpressed plasma cells were sensitive to the early bortezamib and dexamethasone therapy, and correlated to the progression and long term outcome of multiple myeloma.
22781569 NOTCH1 gene may function as an oncogene by regulating HES1/PTEN in invasive bladder transitional cell carcinoma, and its aberrant activation promotes cell proliferation.
22780927 The Notch1 signaling pathway may play a pivotal role in the occurrence and development of laryngeal squamous cell carcinoma.
22768113 These results reveal a functional hierarchy within the leukemia initiating cell population based on NOTCH1 activation
22718117 NOTCH1 signaling is functionally involved in the pathogenesis of Sezary syndrome.
22715413 Notch1-induced WISP-1 expression appeared to be Wnt11-dependent, but Wnt1-independent
22705236 Down-regulation of Notch1 and Notch3 in two hepatocellular carcinoma cell lines resulted in Hes1 down-regulation, CDKN1C/P57 up-regulation, and reduced cell growth.
22695916 Notch1 controls T-cell development, in part by regulating the stage- and lineage-specific expression of IL-7R. (Review)
22684561 Our study concluded that microRNA-34a antagonizes Notch1 and inhibits cell migration and invasion of bladder cancer cells, which indicates the tumor-suppressive function of microRNA-34a in bladder cancer.
22684560 It was concluded that miR-34a may suppress the proliferation and induce apoptosis of U87 cells by decreasing the expression of target gene Notch1, suggesting that miR-34a may become a promising gene therapeutic target for brain glioma.
22673746 Aberrant and constitutively active NOTCH1 signaling triggered by activating mutations in the NOTCH1 gene contributes to oncogenic transformation and is a hallmark of T-cell acute lymphoblastic leukemia. (Review)
22665268 Fibulin-3 promotes glioma growth and resistance through a novel paracrine regulation of Notch signaling.
22619094 NOTCH1 mutations in chronic lymphocytic leukemia with isolated trisomy 12 are associated with other chromosomal alterations
22585622 Notch1 signaling modulates the response of effector T cells to Treg cell-mediated suppressive effects.
22581828 results suggest that Notch1/STAT3/Twist signaling axis is involved in progression of human gastric cancer and modulation of this cascade has potential for the targeted combination therapy
22571487 Study documents that NOTCH1 mutations are an independent prognosticator of CLL transformation into clonally related RS, whereas they have no impact on the development of clonally unrelated RS.
22546285 Studies idicate that NOTCH, BMP4 and WNT pathways are involved in the regulation of intestinal cancer stem cells.
22535768 Data suggest that in the endometrium, Notch1 has a dual role during the window of uterine receptivity.
22526456 immunohistochemical analysis of NOTCH1-3, JAGGED1, cMET, and phospho-MAPK in 100 carcinomas of unknown primary
22510873 the spectrum of oncogenic lesions activating NOTCH1 signaling in human T-ALL.
22506064 Compared to non-tumor tissues, Notch1 and Jagged1 expression was significantly elevated both in mRNA and protein levels in tumors.
22491738 NOTCH1 mutations are associated with pediatric T-cell acute lymphoblastic leukemia.
22490851 Notch1, MMP-2 and MMP-9 are closely correlated with the progression and prognosis of malignant gliomas. Notch1 may participate in the expression regulation of MMP-2 and MMP-9
22479394 Data show that the Notch-1-Furin interaction is regulated by the non-receptor tyrosine kinase, c-Src.
22463491 Data indicate a functional link between the Notch1 and PI3K/Akt pathways in clear cell renal cell carcinoma (CCRCC).
22438124 Induction of miR-34a decreased the expression of Notch-1.
22424712 Notch-mediated repression of miR-223 contributes to IGF1R regulation in T-cell acute lymphoblastic leukemia.
22393458 Notch activation provides Id1-expressing tumor cells with selective advantages in growth and survival
22378079 The tissue labeling index of Notch-1 in endometrial glandular and stromal breakdown immunohistochemistry is significantly lower than that in endometrial adenocarcinoma cells.
22363487 The hypoxia-induced decrease of miR-34a expression could promote epithelial-mesenchymal transition in renal tubular epithelial cells by directly targeting Notch1 and Jagged1, and subsequently, Notch downstream signaling.
22357466 The expression level of Notch1 in T-ALL children was higher than in B-ALL children (P<0.01).
22349824 results indicate that NOTCH1 mutation stimulates T-cell acute lymphoblastic leukaemia cell migration through RhoU upregulation that could contribute to the leukaemia cell dissemination
22348356 The Notch1-JAG1 axis may enhance the invasive properties of endometrial carcinomas, which suggests the Notch pathway may be a promising target for the treatment of this malignancy.
22348144 eIF6 is one of the downstream effectors of Notch-1 in the pathway that controls cell motility and invasiveness in tumor cell lines
22330335 Reduction of NOTCH1 expression directs the basal cells to cease terminal differentiation and to form an immature epithelium, thereby playing a major role in the histopathogenesis of epithelial dysplasia.
22325781 Association of CSL with NICD exerts remarkably little effect on the exchange kinetics of the ANK domain, whereas MAML1 binding greatly retards the exchange kinetics of ANK repeats 2-3.
22311010 The relationship of Notch1 mutation in T-cell acute lymphocytic leukemia (T-ALL) with the survival rate of T-ALL patients.
22279105 Epithelial cell-intrinsic Notch transgene signaling ensures integrity and homeostasis of intestinal epithelial cells, a mechanism required for containment of intestinal inflammation.
22275240 Our findings indicate that Notch-1 is expressed in synovial tissue and that increased notch-1 intracellular domainexpression is associated with low in vivo tissue oxygen levels.
22271085 The functional role of Notch in human papillomaviridae-mediated transformation is dosage dependent and correlated to a change in AP-1.
22249266 findings underline a new, previously undescribed autocrine signaling loop between Notch1 and NRG1 that controls melanoma growth
22225590 NOTCH1 mutations did not impact on T-cell leukemia prognosis.
22218807 Suggest that hepatitis B virus X protein may promote the progression of hepatocellular carcinoma via the activated Notch pathway.
22210878 NOTCH1 mutations are associated with adverse outcome in mantle cell lymphoma.
22207691 the biological contribution of NOTCH1 mutations to determine a poor outcome. NOTCH1 mutations refine the intermediate prognosis of +12 CLL.
22199353 Fe65 carries out different functions depending on its location in the regulation of Notch1 signaling.
22197545 Exacerbation of psoriasis was significantly associated with intense Notch-1 expression
22196886 Levels of activated NOTCH1 are significantly higher in hepatocellular carcinoma tumors than in normal liver tissues.
22194996 high miR-449a levels targeted and reduced both NOTCH1 and KLF4.
22182918 data provide data on the frequency of NOTCH1 exon 34 in chronic lymphocytic leukemia
22173954 Silencing of Notch-1 using siRNA reversed the EMT phenotype and restored sensitivity to gefitinib in PC9/AB2 cells.
22171922 Activating mutations of NOTCH1 are not a common pathogenetic mechanism in MALT lymphomas.
22150311 discuss potential approaches to targeting NOTCH1 in hematopoietic malignancies, including inhibition of enzymes involved in activation, antibodies directed against the receptor or its ligands, and direct interference with NOTCH1 transcriptional complex
22143792 Notch1 regulates the expression of the multidrug resistance gene ABCC1/MRP1 in cultured cancer cells
22128911 NOTCH1 intracellular domain interaction with Snail was found to induce ubiquitination and MDM2-dependent degradation of SNAIL.
22123293 Studies indicate that pathways of Hedgehog (Hh), Wnt and Notch, which regulate development during embryonic life and somatic stem cells (SCs) in the adult organism, can be reactivated in malignancies and support tumor-initiating cells (TIC) scompartment.
22118425 this study shows the significant association between the Notch1 receptor and poor prognostic factors, including lymph node metastasis, in patients with papillary thyroid cancer.
22116551 cooperation between aberrant expression of RasGRP1, a strong activator of Ras, and secondary gain-of-function mutations of NOTCH1 have an important role in T-cell leukemogenesis
22110751 loss of Notch signaling contributes to aortic valve calcification via a Sox9-dependent mechan
22101766 Both MAST and Notch-family gene fusions have substantial phenotypic effects in breast epithelial cells.
22093097 Notch activation-stimulated beta-catenin and NF-kappaB signaling synergistically promote the migratory and invasive properties of glioma cells
22084425 Notch-1 and Notch-4 receptors are overexpressed in tumor and vascular endothelial cells in triple-negative breast cancer.
22080880 Notch1, Jagged1, and Delta1 expressions might be useful markers for clinical prognosis of ovarian carcinomas. High Notch1 immunoreactivity was shown in spheroids. Notch1 immunohistochemistry correlated with metastasis of ovarian cancer.
22077063 Mutations of NOTCH1 are associated with chronic lymphocytic leukemia.
22075757 regulation of proliferation in nuclear ER-positive endometrial cancer cells is mediated by both ER-Notch signaling and GPR30-PI3K/AKT signaling.
22075160 Notch1 monoclonal antibodies inhibited ligand-dependent expression of downstream target genes of Notch, decreased cell proliferation, and induced apoptotic cell death.
22066479 Detection of Notch1, Notch4, and DLL4 in thyroid glands and their regulation in various pathologies suggest that this pathway may play a role in thyroid carcinogenesis and angiogenesis.
22065781 Notch has a role in cellular energy homeostasis, and Notch signaling is required for metabolic flexibility
22052196 abnormal Notch1 expression was strongly associated with hepatocellular carcinoma metastatic disease, which might be mediated through the Notch1-Snail1-E-cadherin pathway
22038626 NOTCH1 is upregulated in skin cancer tissue on skin; results showed that NOTCH1 affected skin cancer cell motility by changing the expression of E-cadherin
22030773 Notch-1 and Jagged-2 are not expressed in spastic colon segments, which may be associated with the pathogenesis of Hirschsprung disease.
22027644 The aim of this study was to investigate the role of Notch signaling in the cell fate specification of ghost cells in calcifying cystic odontogenic tumor.
22022427 The Notch ankyrin repeat domains differ in their leukemogenic potential, and that this difference correlates with activation of Myc.
22020917 DLL4 and Jagged1 siRNA gene therapy mediated by adenovirus may be useful for inhibiting growth and invasion of SGC7901 through a Notch/VEGF pathway.
22006338 study describes a spectrum of inactivating somatic mutations of Notch receptors in lung and skin cancers, indicating that Notch loss of function plays a prominent role in multiple variants of squamous cell carcinomas
22004682 down regulation of uriokinase plasminogen activator (uPA) or uPA receptor results in the inhibition of glioma cell invasion via inhibition of Notch 1 receptor cleavage, signaling and endosomal trafficking of the Notch 1 receptor
21993686 Low prevalence of NOTCH1 mutations in monoclonal B-cell lymphocytosis.
21993533 NOTCH1 receptor expression is up-regulated in clear cell renal cell carcinoma, and it may regulate PTEN expression and the activity of the PI3K/AKT pathway via HES1
21993452 Down-regulation of Notch1 could be an effective approach for inhibition of the expression of matrix metalloproteinase (MMP)-2 and MMP-9 resulting in the inhibition of invasion and metastasis.
21989054 results show that aberrant Notch-1 activation, Bcl-2 overexpression and increased cell survival are likely to play a crucial role in neoplastic transformation associated with E-cadherin impairment
21984373 Notch1 regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia.
21979940 Studies indicate that that Notch signaling plays pivotal roles in the onset and development of T- and B-cell acute lymphoblastic leukemia by regulating the intracellular molecular pathways involved in leukemia cell survival and proliferation.
21939555 NF-kappaB and Notch1 signaling contribute to lymph nodes metastasis and tumor-induced lymphangiogenesis of esophageal squamous cell carcinoma (ESCC), and reveal that up-regulation of NF-kappaB is associated with down-regulation of Notch1 in tumor tissue.
21938432 SEPT4 is a Notch target gene.
21909072 findings show that IRF6 is a primary Notch target in keratinocytes, which is involved in its more indirect 'non-canonical' effects on differentiation
21892768 These results exhibited highly aggressive progression, suggesting that Notch-Ras cooperation maybe lead to poor prognosis.
21892607 This study is the first illustration of Notch-1 and Jagged-2 expression in human tissues from non-cancerous disease.
21881870 downregulated expression of Notch 1 was related to invasion and differentiation status of oral carcinoma cells.
21880637 in T-cell acute lymphoblastic leukemia, PHF6 mutations are a recurrent genetic abnormality associated with mutations of NOTCH1, JAK1 and rearrangement of SET-NUP214.
21876634 Data suggest that LSF is a key mediator of the Notch1 signaling pathway, suggesting that it might be a novel therapeutic target for the treatment of hepatocellular carcinoma.
21869831 Notch1 signaling has an important role during early stages of chondrogenic lineage determination by regulation of Sox9 expression.
21868761 KLF5 transactivates NOTCH1 in the context of p53 mutation or loss. KLF5 loss limited NOTCH1 activity and was sufficient on its own to transform primary human keratinocytes harboring mutant p53, leading to the formation of invasive tumors.
21857154 The expression of Notch1 mRNAs and proteins is repressed by overexpression of miR-449. [review]
21841793 Study reveals a previously unrecognized function of Notch in negatively titrating active beta-catenin protein levels in colonic tumor cells.
21835957 Low ERG and BAALC expression (E/B(low)) and NOTCH1/FBXW7 (N/F) mutations have been proposed as powerful prognostic markers in large cohorts of adult T-ALL.
21820430 The results indicate that JICD functions as a negative regulator in Notch1 signaling via the promotion of Notch1-IC degradation.
21818118 Hypoxia-inducible factor-1alpha (HIF-1alpha) induced activation of Notch pathway is essential for hypoxia-mediated maintenance of glioblastoma stem cells.
21810559 Notch signaling molecules, Notch1 and Jagged1, are morphogenesis regulation factors closely related to cytological differentiation in neoplastic cells of ameloblastoma.
21807868 IGF1R is a Notch1 target, and Notch1 signaling is required to maintain IGF1R expression at high levels in T-ALL cells.
21798897 identified mutations in FBXW7 and NOTCH in head and neck squamous cell carcinoma; nearly 40% of mutations in NOTCH1 predicted to truncate the gene product, suggesting NOTCH1 may function as tumor suppressor gene rather than oncogene in this tumor type
21798893 at least 30% of head and neck squamous cell carcinoma (HNSCC) cases harbored mutations in genes that regulate squamous differentiation (for example, NOTCH1, IRF6, and TP63), implicating its dysregulation as a major driver of HNSCC carcinogenesis
21785827 Results showed that reduction of Notch1 levels impacted the phosphorylation of PAK, phosphorylation of Akt, phosphorylation of FAK, the phosphorylation of integrin beta1, ICAM-1 and beta-catenin.
21778948 Notch1 expression correlated with lower overall survival in patients with glioma
21775206 The identification of activating point mutations in NOTCH1 in more then 50% of all T-ALL cases highlights the NOTCH1 cascade as a central player of T-ALL pathogenesis. (Review)
21771876 Notch1 is an independent predictor of prognosis for patients with colorectal cancer. In addition, the predictive role of Notch1 on clinical outcome might be modified by p65 status.
21768114 mechanistic and functional insights into TLR2- and NOD receptor-mediated regulation of dendritic cell functions and unravels NOTCH1-PI3K as a signaling cohort for TLR2 and NOD receptors
21761283 A regulatory role for DLK1 in human and mouse neural progenitor differentiation and an interaction between DLK1 and Hes1-mediated Notch signaling in these cells, are reported.
21756827 There is an overall hypomethylation of Notch1 gene in breast invasive ductal carcinomas with corresponding over-expression of Notch1 protein.
21743299 miR-34a is downregulated in glioblastoma multiforme cells and inhibits growth by targeting notch1
21737748 there is a conserved network of cis-regulatory factors that interacts with Notch1 to regulate gene expression in TLL cells, as well as unique classes of divergent RBPJ-only sites that also likely regulate transcription
21685328 Study highlights the importance of Notch 1 signaling in T helper type (Th)17 cell differentiation; blockade of Notch signaling significantly downregulates production of Th17-associated cytokines.
21679465 results from this study demonstrate that Notch-1 and Notch-4 are novel transcriptional targets of PEA3 in breast cancer cells
21673954 HCV NS3 protein is involved in the activation of the Notch-signaling pathway through the targeting to both SRCAP and p400
21670202 mutational activation of NOTCH1, observed in 8.3% of CLL at diagnosis, was detected at significantly higher frequency during disease progression toward Richter transformation (31.0%), as well as in chemorefractory CLL (20.8%)
21667253 siRNA-mediated silencing of the Notch-1 gene may represent a novel target for gene therapy of glioblastoma multiforme.
21665937 Notch1 signaling plays an important role in the formation of brain metastases from breast cancer.
21643850 signaling is regulated by Delta-like 1 intracellular domain via the disruption of the Notch1-IC-RBP-Jk transcription activator complex
21632454 Valproic acid activates Notch1 signaling in vivo and may have a role in treating low-grade neuroendocrine tumors.
21631271 There might be a role for the Notch1 and mTOR pathways in the pathogenesis and therapy of plasmablastic lymphoma.
21629222 we present a novel approach, using imagable mesoporous silica nanoparticles as vehicles for targeted delivery of GSIs to block Notch signaling.
21625236 results provide further insight on the mechanisms that control the activation of oncogenic NOTCH1 mutants and identify ADAM10 as potential therapeutic target for the inhibition of oncogenic NOTCH1 in T-ALL
21622856 Introduction of small interfering RNA directed against Notch1 reduces epidermal growth factor receptor-induced mucin 5AC oligomeric mucus MUC5AC expression in a lung carcinoma cell line.
21602795 Notch1 and its ligand Delta-like 1(DLL1) are miR-449 bona fide targets
21558417 Collectively, our results demonstrate that APP intracellular domain functions as a negative regulator in Notch1 signaling through the promotion of Notch1 and RBP-Jk protein degradation
21556011 identical NOTCH1 mutations in the leukemias of the sibling pair occurred most probably at different times.
21518768 Notch up-regulates the expression of the long form, but not the short form, of ADAM12 containing a divergent 3'-untranslated mRNA region
21516124 This study shows that constitutive activation of the Notch1 pathway confers fibroblasts with a suppressive phenotype to melanoma growth, partially through WISP-1.
21498615 Pulsatile flow promotes BREC survival and enhances BRP apoptosis through modulation of Notch and hedgehog pathways. These interactions have important implications for the pathogenesis of retinopathies.
21481777 Data provide insight about the mechanism of Notch1 activation.
21480340 Notch1 expression in HCC tissues and cell lines is differentially affected by p53WT and mutant p53 (p53Mut).
21471519 Data show that Notch1 to -3 may have potential use as a strong prognostic factor.
21471203 Notch1 intracellular domain.RBPJk complex enhances the BMP2-induced Msx2 gene expression by cooperating with Smad1 and suggest that Notch signaling makes vascular SMC responsive to BMP2 and promotes vascular calcification.
21466361 This study demonstrated a close correlation of Notch2 expression with gastric cancer formation and the potential link of Notch1 upregulation with intestinal-like phenotypes of gastric lesions.
21464222 miR-451 and miR-709 function as potent suppressors of oncogenesis in NOTCH1-induced mouse T cell acute lymphoblastic leukemia (T-ALL), and miR-451 influences MYC expression in human T-ALL bearing NOTCH1 mutations.
21463919 High NOTCH1 is associated with pancreatic cancer.
21457232 two novel de novo mutations in NOTCH1, 23 rare patients inherited gene variants in NOTCH1
21420785 nasopharyngeal carcinoma cells may up-regulate Notch signaling to maintain cell proliferation
21398698 DDR1 exerts prosurvival effect, at least in part, through the functional interaction with Notch1.
21362320 Through activating the Dll4-Notch-Hey2 signaling pathway, HGF indirectly promotes the proliferation and migration ability of cells, so that offspring artery branches are formed.
21342503 Notch signaling contributes to the maintenance of both normal neural stem cells and patient-derived glioma stem cells.
21326611 Inhibition of NOTCH signaling abrogated growth of cell lines derived from the TLX1-induced tumors. NOTCH inhibition also transiently delayed leukemia progression in vivo.
21308734 Results suggest that antitumor activity of curcumin is mediated through a novel mechanism involving inactivation of Notch-1 and NF-kappaB signaling pathways.
21302811 four novel mutants in the HD and PEST domain of Notch-1 receptor add new insights into the genetic heterogeneity of T-cell acute lymphoblastic leukemia.
21280156 KLF9 regulates glioblastoma neurosphere cells by binding to the Notch1 promoter and suppressing Notch1 expression and downstream signaling.
21277031 Copy number variations in NOTCH1 among a Chinese Han population are associated with tetralogy of Fallot and ventricular septal defect.
21251836 findings confirm that Notch1 expression is upregulated in glioma and suggest it is related to tumor progression.
21245387 Intracellular domain of Notch multimerizes and that these multimers function as precursors for the stepwise assembly of the Notch activation complex.
21238798 In this study, Notch 1 receptors were detected in the lining epithelium of human periapical cysts with limited inflammation, showing Notch pathway activation in those cells.
21224848 The ZEB1/miR-200 feedback loop controls Notch signalling in cancer cells.
21196490 NOTCH is a new signaling pathway involved in holoprosencephaly.
21165952 We conclude that Ishikawa cells contain a subpopulation of cells with stem cell-like properties. Musashi-1 modulates endometrial carcinoma cell cycle progression and apoptosis via the stemness-related factors Notch-1, Hes-1 and p21(WAF1/CIP1)
21147854 SGK1 inhibits the Notch1 signaling pathway via phosphorylation of Fbw7.
21145176 Notch1 and Jagged1 are up-regulated in human colon adenocarcinoma and suggests that Notch1/Jagged1 signaling might play a role in the development of colon adenocarcinoma.
21124806 Data show no detectable difference in the DNA binding site preferences of CSL before and after loading of four different Notch receptors and MAML1 proteins.
21119685 By shifting monomeric E3 ligase complexes to dimeric forms through activation of Asb2 transcription, Notch could effectively control the turnover of a variety of substrates and it exerts diverse effects on cell proliferation and differentiation.
21056041 Lamina propria lymphocytes promote intestinal mucosal barrier function, which is associated with activation of the Notch-1 signaling pathway.
21052088 inhibition of two oncogenic pathways (AURKA and NOTCH-1) by small-molecular inhibitors induced significant growth arrest in NK-cell lines
21042738 Short GC-rich RNA similar to miR 1909 and 1915 folds in silico with the 5'-UTR and ORF of Notch and responders.
20978353 Results establish that epithelial injury and Notch1 signaling play key roles in fibrosis development and indicate that Notch blockade may be a therapeutic strategy to reduce fibrosis and ESRD development.
20965628 This review is an update on the current understanding of the molecular basis of T-cell acute lymphoblastic leukemia, with a particular focus on the role of the NOTCH1 oncogene.
20962575 Notch-1 signaling is involved in the upregulation of survivin expression in lung cancer cells, which is synergized by HIF-1alpha.
20951801 Data show that NOTCH1 variant with improper localization to the ER and decreased presentation at the cell surface.
20950370 Data show that, in clinical breast cancer specimens, the expression level of p63 was also found to positively correlate with the expression level of Notch1.
20944675 Inactivation of the ubiquitin ligase FBXW7 is associated with rapid early treatment response and synergizes with NOTCH1 receptor activation.
20930168 EtOH inhibits Notch signaling and, subsequently, smooth muscle cell proliferation, in vitro and in vivo.
20861920 NOTCH1 and FBXW7 mutations have a favorable impact on early response to treatment, but not on outcome, in children with T-cell acute lymphoblastic leukemia (T-ALL).
20861909 prognostic significance for NOTCH1/FBXW7 mutations is not consistent and may depend on the treatment protocol given.
20861909 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20827750 Interaction of hypoxia-inducible factor-1alpha and NOTCH1 regulates medulloblastoma precursor proliferation and fate.
20823234 activated Notch may be important to ATL pathogenesis and reveal Notch1 as a target for therapeutic intervention in ATL patients
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20819128 The expression Notch1 protein in tongue carcinoma was higher than adjacent non-neoplastic tongue tissues. Notch1 was significantly more highly expressed in lymph node metastasis-positive tongue carcinoma.
20817637 Provide evidence of Notch1-dependent endothelial FGF-2 induction by visfatin and of Notch1 activation in visfatin-stimulated endothelial angiogenesis.
20813007 study showed that the NOTCH1 PEST domain mutation is a marker of poor prognosis in a minority of B-cell chronic lymphocytic leukaemia patients
20812035 Activation of Notch pathway may indicate a poor prognosis in acute myeloid leukemia, especially, Notch1, Jagged1 and Delta1 expression.
20801121 the cross talk of N3 with N1 during differentiation provides novel, mechanistic insights into Notch signaling and esophageal squamous epithelial biology
20800871 Our results indicate importance of NOTCH1 and JAGGED1 expression in plasma cell neoplasia and a possible diagnostic value of their immunohistochemical evaluation of bone marrow infiltrates for multiple myeloma.
20740684 Runx2 is an inhibitor of the Notch1 signaling pathway during normal osteoblast differentiation
20736329 Data suggest that Notch signaling could be a therapeutic target for NB.
20730882 presence of the NOTCH1 activating mutation in MNKL might suggest a possible role in the leukemogenesis of MNKL.
20683149 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20683149 NOTCH1 mutations were not associated with pediatric T-ALL.
20578140 these results reveal a novel function of HBx in blunting senescence-like growth arrest by decreasing Notch1 signaling, which could be a putative molecular mechanism mediating HBV-associated hepatocarcinogenesis.
20554499 Notch1 receptors and their ligands play differential roles in the cytodifferentiation of squmous odontogenic tumors of the mandibl.
20551051 Authors identified Notch1 signaling as an ADAM17-controlled pathway and a critical regulator of anchorage-independent growth by using both Notch1 shRNA and ectopic expression of the active intracellular Notch1 fragment.
20538790 Immunohistochemistry of 40 biopsies taken from skin lesions of mycosis fungoides and Sezary syndrome demonstrated prominent expression of Notch1 on tumor cells, especially in the more advanced stages.
20517681 high-level coexpression of Jagged-1 and Notch-1 in head and neck tumors may posses an overactive Notch signaling cascade to induce the tumor progression.
20515335 Supratentorial PNETs expressed significantly higher levels of SOX2, NOTCH1, ID1, and ASCL-1 transcripts.
20491628 Studies indicate that Notch signaling is initiated when Notch ligand binds to an adjacent Notch receptor between two neighboring cells.
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20479883 These results provide direct and unambiguous evidence that the NECD forms a dimer.
20459529 data demonstrate that aberrant Notch regulation is an early event in mammary carcinogenesis and is associated with the HER-2 molecular subtype of breast cancer
20454918 transport of Notch intracellular domain into the nucleus is mediated by the canonical importin alpha/beta1 pathway.
20444726 Notch-1, Notch-4, and Jagged-1 are highly expressed in different subcellular locations in the breast cancer cell
20443831 Cyclin D1 functions downstream as a genetic target of Notch1, amplifies Notch1 activity by repressing Numb, and identifies a novel pathway by which ErbB2 induces Notch1 activity via the induction of cyclin D1.
20442780 the two factors Klf4 and Sp3 exert an overlapping repressor function through their binding to the Notch1 promoter.
20418862 revealed a striking difference between the responses of Notch to trans- and cis-Delta: whereas the response to trans-Delta is graded, the response to cis-Delta is sharp and occurs at a fixed threshold, independent of trans-Delta
20388374 Notch signaling pathway regulates small cell lung cancer cells through its inhibitory effect on hASH1 transcription via HES1.
20372862 Notch-1 can positively regulate Akt-mTOR pathways, which are associated with glioma cell proliferation and apoptosis.
20368328 Notch and TGFbeta coordinately induce a molecular and functional contractile phenotype by co-regulation of Smad activity at SMC promoters
20351309 Data suggest a novel model that the endothelial cell fate regulators, Notch, COUP-TFII, and Prox1, are under an exquisite feedback control mechanism and dynamically regulate each other in LECs.
20351182 Notch1-floxed mice crossed with E8I-cre transgenic mice inoculated with EG7 thymoma cells die comparable to control mice, indicating that Notch2 is crucial for exerting antitumor cytotoxic T lymphocyte responses.
20348880 Notch1 was expressed in the majority of HHV-8-positive primary effusion lymphoma cases, corroborating the notion that Notch1 may have an important role in HHV-8-mediated lymphomagenesis of primary effusion lymphoma.
20348013 These results suggest a direct role for Notch signalling via the Snail pathway in the development of epithelial to mesenchymal transformation and renal fibrosis.
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20346213 Celastrol could downregulate Notch1 in U937 cells.
20339081 the NIC-Akt-Mfn signaling cascade identifies a pathway regulating cell-survival, independent of canonical functions associated with NIC activity
20336604 Studies indicate that understanding the contributions of Notch, Wnt and HH signaling to the development of hematopoiesis is critical for achieving successful ex vivo expansion and differentiation of hematopoietic stem cells hematopoietic stem cells.
20206691 analysis of notch- and vitamin D signaling in 1,25(OH)2D3-resistant glioblastoma multiforme (GBM) cell lines
20204271 -regulation of Notch-1 signaling caused cancer cell growth inhibition by apoptosis induction.
20194747 These results indicate that the phenotypic responses to Notch are determined by the dose of pathway activation.
20193454 Notch1 protein was overexpressed in breast invasive ductal carcinoma. High expression correlated significantly with lymph node metastasis, pathological grades and TNM stages.
20193370 There might be a cross-talk of bi-directional control between Notch1 and EGFR signaling in regulating the cellular proliferation of human tongue squamous carcinoma cells.
20193271 Inhibiting the Dll4/Notch signal transduction pathway stimulates the proliferation of HUVEC and facilitates angiogenesis.
20154720 Notch-1 stimulates survival of lung adenocarcinoma cells during hypoxia by activating the IGF-1R pathway.
20147635 Activated Notch1 protein levels are significantly increased in the brains of most patients with tuberculous meningitis compared with healthy subjects brains.
20146266 profiled the gene expression in mesenchymal stem cells in response to TGF-beta, and showed that TGF-beta induced Notch ligand Jagged 1 (JAG1) and smooth muscle cell markers.
20145124 Inhibition of NOTCH signaling may improve CRC chemoprevention and chemotherapy.
20118921 NLK negatively regulates Notch-dependent transcriptional activation by phosphorylating Notch1ICD. Phosphorylated Notch1ICD is impaired in its ability to form a transcriptionally active ternary complex.
20106965 the large hydrophilic loop of PS1 appears to differentially regulate the relative production of different Abeta peptides without affecting Notch processing
20069356 The pattern of Notch gene expression mirrors the progression from immature cells to endothelial-lined vascular channels (i.e., endothelial differentiation) that characterizes the growth and involution of infantile hemangioma.
20060575 Notch 1 was frequently expressed in ovarian cancer cell lines and human ovarian cancer specimens. Importantly, depletion of Notch 1 led to growth inhibition of ovarian cancer cells.
20058190 High level of Notch1 protein is associated with colorectal cancer.
20052673 down-regulation of Notch-1 or Jagged-1 mediated inhibition of cell growth, migration and invasion, and the induction of apoptosis was in part due to inactivation of Akt, mTOR, and NF-kappaB signaling pathways.
20040020 Notch signaling may participate in controlling cell differentiation and proliferation in normal bone and COF of the jaws. Notch signaling disorder may be a molecular incident in COF occurrence and development.
20036815 Studies indicate that the imbalance of pro-angiogenic and anti-angiogenic factors VEGFA, Notch, Dll4, PDGF and angiopoietin-1 promotes tumor angiogenesis.
20012562 High Notch1 expression is associated with tumor differentiation status in ovarian carcinoma.
20008221 This review focuses on the molecular basis of NOTCH1-induced transformation, the mechanisms of action of oncogenic NOTCH1 and clinical significance of NOTCH1 mutations in T-ALL. Review.
19956862 inhibition of Notch signaling could antagonize survival signal of Her2-negative breast cancer-initiating cells carrying genomic damage
19953094 RhoC is an effector of Notch1 in cervical carcinoma cells. There is a pro-oncogenic role of Notch signalling in human cervical cancers.
19923082 Notch1 may be an anti-oncogene in ESCC and affects cell differentiation in early stage of the malignancy. The Notch1 pathway might play a key role in microvascular angiogenesis.
19914349 5'-Nitro-indirubinoxime induces cell cycle arrest and apoptosis in salivary gland cancer by inhibiting Notch-1 protein signaling, and may be thus used as a therapeutic agent.
19901516 Studies indicate that signaling pathways of STAT3, NOTCH, hedgehog and transforming growth factor-beta (TGFbeta), which are involved in stem cell renewal, differentiation, survival, and are commonly deregulated in HCC.
19847202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19838210 Data support a model in which Notch-1 can activate the transcription of ERalpha-target genes via IKKalpha-dependent cooperative chromatin recruitment of Notch-CSL-MAML1 and ERalpha, which promotes the recruitment of p300.
19812212 Activation of Notch-1 is a feature of brain arteriovenous malformations; activation of Notch-1 in normal vasculature induces a pro-angiogenic state, which may contribute to the development of vascular malformations.
19808903 This study first reports HES1-dependent SRC/STAT3 pathway that provides a functional link between Notch signaling and hypoxia pathway.
19800882 RUNX3 suppresses Notch signaling in hepatocellular carcinoma SMMC7721 cells by its interaction with ICN1 (intracellular domain of Notch1) and thus recruitment to the RBP-J recognition motif of downstream genes of Notch signaling.
19799080 Notch1 signal activation can inhibit the proliferation and neuroendocrine marker expression in small cell lung cancer cells, and may behave as a tumor suppressor.
19794083 There is a high frequency of NOTCH1 mutations in adult T-lymphoblastic leukemia.
19778842 review of NOTCH1 signaling in T-cell acute lymphoblastic leukemia [review]
19771395 These results suggest that Notch1 plays an important oncogenic role in the development and progression of astrocytic gliomas.
19751190 Studies indicate that MAML1 functions as a coactivator for the tumor suppressor p53, MEF2C, beta-catenin and Notch signaling.
19728763 Decreased NOTCH1 expression is associated with hepatocellular carcinoma.
19725072 The role od notch signaling in the development of haematopoietic stem cells during vertebrate embryogenesis, is reviewed.
19724883 Findings suggest a positive feedback loop between Notch1 and DLL1 in the U251MG glioma cell line.
19724860 the Notch1 signaling pathway is a potential target for laryngeal carcinoma.
19717984 Results suggest that KLF4 could contribute to breast tumor progression by activating synthesis of Notch1 and by promoting signaling through a non-canonical Notch1 pathway.
19704010 ADAM10 was absolutely required for N1 signaling induced by ligands, while signaling independent of ligands required ADAM17.
19701457 S1 cleavage has distinct effects on the surface expression of Notch1 and Notch2, but is not generally required for physiologic or pathophysiologic activation of Notch proteins
19700410 Ovol2 directly represses two critical downstream targets, c-Myc and Notch1, thereby suppressing keratinocyte transient proliferation and terminal differentiation, respectively
19686049 Data indicate the existence of an interconnected transcriptional network characterized by higher levels of NOTCH1, NF-kappaB, and other important TFs on more primitive HSC sets.
19682396 Our results indicate that the human embryonic stem cell-derived neral stem cells maintain stem cell characteristics mainly through Notch signaling, which suggests that they could be an in-vitro model for in-vivo neurogenesis.
19680556 Observational study of gene-disease association. (HuGE Navigator)
19635999 Data show that analysis by each marker individually was not significantly predictive of outcome: NOTCH1 MUT v WT, EFS 49% v 34%, P = .20; and FBXW7 MUT v WT, EFS 53% v 41%, P.72.
19631984 NOTCH1 and MLL abnormalities are primary leukemogenic hits in early T-ALL.
19604236 A PEST domain mutation i.e. 7544_7545 DEL (CT) was found in 2/43 patients (4.6%) with B-CLL.
19603167 Notch1 expression were elevated in immune thrombocytopenic purpura.
19590514 Observational study of gene-disease association. (HuGE Navigator)
19550121 Data show that Notch1 expression is negatively correlated to DDP-sensitivity of head and neck squamous cell carcinoma, and could be used to predict DDP-sensitivity.
19549918 The use of a constitutively active, truncated Notch transgene construct was used to determine if Notch1 activation or a "driving" event in melanocytes is associated with melanoma progression.
19491270 results suggest that activation of Notch1 signal pathway promotes progression of gastric cancer, at least in part through COX-2
19479935 Defects in Notch-1 signaling may play a role in human prostate tumor formation in part via a mechanism that involves regulation of the PTEN tumor suppressor gene.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19407245 Sonic Hedgehog induces Notch target gene expression in vascular smooth muscle cells via VEGF-A
19404845 expression levels of Notch1 and Notch4 were absent or significantly decreased in renal cell carcinoma tissues
19396152 In contrast with neuroendocrine tumors in other tissues, evident Notch-1 expression was found in Merkel cell carcinoma.
19376776 enhancement of TRAIL-induced apoptosis by Notch1 signaling is dependent upon p53 up-regulation
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19349467 Notch1 controls early T cell development, in part by regulating the stage- and lineage-specific expression of IL-7Ralpha.
19340001 In T-ALL, NOTCH1 mutations resulted in 1.3- to 3.3-fold increased transactivation of an HES1 reporter construct and consequent upregulation of several chemotherapy relevant genes.
19340001 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19339697 Notch signaling in B cells and B-cell lymphomas is only compatible with proliferation if pathways leading to antiapototic signals are active.
19247952 Studies indicate that the mechanisms that lead to Notch activity in the receiving cell include the cleavage of Notch at the cell membrane and the assembly of a nuclear complex with the transcription factors CSL.
19245433 Observational study of gene-disease association. (HuGE Navigator)
19239437 Observational study of gene-disease association. (HuGE Navigator)
19234458 Notch maintains ependymal cell quiescence and phenotype in transgenic mice, suppressing neuronal differentation; after stroke, ependymal cells do not fulfill defining criteria for stem cells, serving instead as a reservoir that is recruited by injury.
19228774 Study reports that human osteosarcoma cell lines and primary human osteosarcoma tumor samples show significant up-regulation of Notch, its target genes and Osterix.
19209236 Neural stem/progenitor cells undergo chromosomal changes with repeated in vitro passages under mitogen stimulation, and up-regulation of hTERT and NOTCH1 associates with in vivo tumorigenicity.
19167678 sustained Notch signaling can replace stroma in differentiation of a common CD7(+) lymphoid precursor from UCB CD34(+) progenitors and induce NK cell commitment. However, the NK cells are immature in their cytokine production profile, are hyporesponsive.
19160126 Notch-1 may be a potential mechanism of bone marrow stromal cells involvement in the protection of hematopoietic malignant cells from drug-induced apoptosis
19151773 A second NOTCH1 chromosome rearrangement: t(9;14)(q34.3;q11.2) is associated with T-cell neoplasia.
19151708 In human breast cancers, we observed a strong correlation between Pin1 overexpression and high levels of activated Notch1. Thus, the molecular circuitry established by Notch1 and Pin1 may have a key role in cancer.
19147749 the involvement of Notch1 in human PCa invasion and that silencing of Notch1 inhibits invasion of human PCa cells by inhibiting the expression of MMP9 and uPA
19122673 Results suggest that repression of HPV18 E6/E7 expression by Notch1 signaling results in the activation of p53-mediated pathways with concomitant growth suppression of HPV18-positive EC109 esophageal carcinoma cells.
19118200 a combinatorial regulatory program in which MYC cobinds to virtually all NOTCH1-bound promoters
19109228 demonstrate that NOTCH1 pathway activation by either NOTCH1 or FBXW7 mutation identifies a large group of patients with a favorable outcome that could justify individual therapeutic stratification for T-cell acute lymphoblastic leukemia
19109228 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19091404 results demonstrated that down-regulation of Notch-1 signaling could sensitize SupT1 cells to adriamycin
19074836 Notch signaling suppresses KLF4 expression in intestinal tumors and colorectal cancer cells
19057901 Downregulation of Notch1 signaling by gamma-secretase inhibitors caused neither cell cycle block nor cell death in T-ALL cells
19047145 Evidence shows Notch-1 is elevated in the malignant setting, Notch-2 is diminished. This differential expression of the two Notch isoforms benefits cancer cell survival because reexpression of Notch-2 was toxic to MM cells.
19025652 High expression of Notch-1 is associated with breast cancer.
19023031 Report requirement for Notch activation during regeneration of the intestinal epithelia.
19008176 Notch1 intracellular domain positive products were observed in the cells at the peripheral layer of most proliferating epithelial tumor nests in mandibular ameloblastoma.
18984862 major role of the NOTCH pathway activation in human T-cell acute leukemia development and in the maintenance of leukemia-initiating cells
18924608 NOTCH1 is an effector of Akt and hypoxia in melanoma development.
18844067 In active phase AA patients, the levels of FOXP3 and Notchl mRNA were lower than that in the control group.
18777195 Notch1 expression correlated closely with colorectal cancer differentiation
18758480 Notch 1 is a tumor suppressor gene under direct p53 control. Review.
18758479 There is a complex interplay between Notch1 signaling & papillomaviruses in the context of cervical carcinogenesis. Moderate Notch1 levels upregulate c-Myc, activate PKB/Akt & induce transformation. High levels can induce apoptosis. Review.
18703315 Wnt (Wnt2), Stat3, and Notch-1 and -2 signaling are correlated in human epidermal tumors.
18664540 Notch signaling is involved in the determination of thyroid cell fate and is a direct regulator of thyroid-specific gene expression.
18663146 K-RasG12D-induced T-cell lymphoblastic lymphoma/leukemias harbor Notch1 mutations
18663143 Slug is up-regulated by Notch in endothelial cells; Slug is required for Notch-mediated repression of the vascular endothelial cadherin promoter and for promoting migration of transformed endothelial cells.
18660822 the conserved face of the Jagged/Serrate DSL domain is involved in Notch trans-activation and cis-inhibition
18633435 arsenite, by decreasing generation of the tumor suppressor Notch1, contributes to skin carcinogenesis
18628966 AIP4/Itch regulates Notch receptor degradation in the absence of ligand
18625637 Data suggest that defects in Notch1 upregulation upon activation of T cells from patients with systemic lupus erythematosus are related to lupus disease activity.
18604200 EGFR is a key negative regulator of Notch1 gene expression in primary human keratinocytes, intact epidermis and skin squamous cell carcinomas
18593982 activation of Notch signaling might play a crucial role in brain metastasis
18593928 ER- breast cancer cells become dependent on Notch-survivin signaling for their maintenance, in vivo.
18593923 Combinations of antiestrogens and Notch inhibitors may be effective in ERalpha(+) breast cancers; Notch signaling is a potential therapeutic target in ERalpha(-) breast cancers.
18593716 Two mutations in the NOTCH1 found in patients with left ventricular outflow tract defects reduce JAGGED1 induced signaling.
18593473 Both in vitro Reelin treatment and overexpression of Notch-1 intracellular domain induced BLBP expression and a radial glial phenotype in an immortalized human neural progenitor cell line, isolated from the cortex of 14 weeks old fetus
18570928 The HDAC inhibitor VPA activates Notch1 signaling in SCLC cells
18560356 Notch-1 stimulates NF-kappaB activity in CaSki cervical cancer cells by associating with the IKK signalosome through IKKalpha.
18559519 Overexpression of notch1 is associated with angiogenesis in breast cancer and neuroblastoma
18552977 The inverse correlation between Notch signaling and the proliferative status of the corneal epithelium is consistent with the idea that Notch plays a role in corneal epithelial differentiation.
18549623 Notch1 and NF-kappaB signaling pathways participate in bortezomib-inducing RPMI8226 cell apoptosis.
18497996 Down-regulation of Notch-1 expression is associated with leukemogenesis in acute myeloid leukemia
18490439 These results indicate that the activated Notch1 receptor and alpha-enolase or MBP-1 cooperate in controlling c-myc expression through binding the YY1 response element of the c-myc promoter to regulate tumorigenesis.
18469855 Notch-1 might play a novel role in resistance to trastuzumab, which could be prevented or reversed by inhibiting Notch-1.
18456406 These results demonstrate that Notch signaling has little relevance with resveratrol-induced differentiation and apoptosis and may not be a universal critical factor of MB cells.
18449208 Notch activation interferes with dedifferentiation of neoplastic B cells in Hodgkin lymphoma
18427106 These data demonstrate a complex integration of the hypoxia and Notch signaling pathways in regulation of epithelial-mesenchymal transition.
18411416 a novel class of activating mutations in NOTCH1, juxtamembrane expansion alleles consisting of internal duplication insertions in the vicinity of exon 28, lead to aberrant activation of NOTCH1 signaling in T-cell lymphoblasts.
18359760 Notch-1 upregulates EGFR expression and also demonstrate Notch-1 regulation of p53 in gliomas.
18354251 Data show that Notch1 are abundantly expressed in osteoarthritis.
18347015 Pofut1 and O-fucose have roles in mammalian Notch signaling
18320325 Report the antitumor effects of COX2 inhibitors may be associated with effects on the Delta1/Notch1 pathway in colon tumor cells.
18311147 activation of the Notch pathway, which is critical in glomerular patterning, contributes to the development of glomerular disease
18296609 Over-expression of constitutively activated Notch1 intracellular domain (Notch-ICD) also inhibited odontoblastic differentiation of DPSCs. Taken together, our results demonstrate Notch signaling can inhibit the odontoblastic differentiation of DPSCs.
18296446 long range calcium-dependent structural perturbations can influence the affinity of Notch for its ligand, in the absence of any post-translational modifications
18292942 Notch1 signaling pathway may participate in carcinogenesis of the esophagus.
18292500 Notch1 signaling affects regulatory T cell effector function via its effect on transforming growth factor (TGF)-beta signaling rather than via a TGF-beta-independent mechanism.
18239137 Present a novel mechanism by which a balance between Notch-1/-2/-4 signaling, via CBF-1, and HRT-1/-2 activity determines the expression of smooth muscle differentiation markers including actin.
18219106 Primary colorectal carcinomas display aberrant expression of vimentin, and have activated Notch and TGFbeta signaling pathways.
18192969 in UV-related squamous cell photocarcinogenesis Notch 1 downregulation could mirror a tumor suppressor function of the receptor, in sun-protected squamous cell carcinomas Notch 1 was upregulated
18192230 The results thus showed that Jag-1-mediated Notch signaling in human bone marrow stromal cells was necessary to initiate chondrogenesis, but it must be switched off for chondrogenesis to proceed.
18184405 NOTCH1 is mutated in T-cell acute lymphoblastic leukemias, but not in other common human cancers
18155729 the RBP-Jkappa-associated domain of Notch increases the effective concentration of the ankyrin domain for its binding site on CSL, enabling docking of the ankyrin domain and subsequent recruitment of the Mastermind-like coactivator.
18084619 Recombinant Notch-1 mediated the stimulating effects of recombinant erythropoietin on cultured cancer-initiating breast cancer cells from 3 cell lines.
18079963 Notch-1 and the Notch ligand Jagged-1 were expressed at significantly higher levels in CCRCC tumors than in normal human renal tissue, and the growth of primary CCRCC cells was attenuated upon inhibition of Notch signaling.
18069660 we conclude that in the ectatic ducts of CP, PDH activates signalling pathways such as Notch, which have transforming potential.
18056171 These results suggest that Notch-1 mutations can sometimes be acquired as secondary events in leukemogenesis and must be used cautiously as solitary minimal residual disease markers.
18055449 The results indicate that cell-cell signaling through the NOTCH system provides a critical cue for the proliferation of human embryonic stem and embryonal carcinoma cell in vitro.
17991315 The positive rate of Notch1 was significantly higher in gastric cancer than in normal gastric tissue.
17984306 Ligand-induced Notch activation, through the induction of Slug, promotes tumor growth and metastasis characterized by epithelial-to-mesenchymal transition.
17980397 These results demonstrate that EBV LMP2A activates the Notch pathway in both B cells and epithelial cells.
17967789 Notch is activated upon coculture of EPCs with neonatal rat cardiac myocytes. Gamma-secretase-dependent Notch activation is required for cardiac gene expression
17948123 Data demonstrate that Notch1 and VEGFR-3 interact genetically, that Notch directly induces VEGFR-3 in blood endothelial cells to regulate vascular development, and that Notch and VEGF signaling may function in tumor lymphangiogenesis.
17927876 The activated Notch1 signaling pathway gives rise to the apoptosis of EC9706 cells.
17922104 The Notch/Ngn3 signalling network is intact and functional in adult islets.
17920003 Expression of Notch 1 receptors was upregulated and Notch signaling might be involved in development of hepatocellular carcinoma.
17901244 NOTCH1 can be an early or initiating event in T-acute lymphoblastic leukemia arising prenatally
17874453 Persistent expression of NOTCH1 in such cancers as adult T-cell leukemia lymphoma suggests that Notch pathway inhibitors could have a role in the treatment of these unusual neoplasms.
17873882 Mutational loss of PTEN induces resistance to NOTCH1 inhibition in T-cell leukemia.
17851046 Human umbilical cord epithelial cells express Notch1 as in epidermal keratinocytes.
17822320 Overexpression of notch1 is associated with breast cancer
17804701 Hypoxia dramatically elevates NOTCH signaling (especially NOTCH-1) in lung tumor cell lines.
17716607 There is no evidence of linkage of bicuspid aortic valve in our pedigree to either the NOTCH1 gene or to the chromosome 15 locus. The disorder in this family appears to be caused by a gene at a novel locus.
17671232 Acute myeloid/T-lymphoid leukemia with silenced CEBPA and mutations in NOTCH1.
17664272 Notch1 ligand, Delta-like ligand-4, stimulates R-Ras-dependent alpha 5 beta 1 integrin-mediated adhesion, demonstrating the physiological relevance of this pathway.
17662764 targeted analysis involving NOTCH1 exons previously implicated in familial and sporadic bicuspid aortic valve demonstrates overrepresentation of NOTCH1 missense variants among patients with bicuspid aortic valves and thoracic aortic aneurysms
17652726 Notch family members and ligands are expressed in the human corneal epithelium and appear to play pivotal roles in corneal epithelial cell differentiation
17646409 FBW7 mutations in leukemic cells mediate NOTCH pathway activation and resistance to gamma-secretase inhibitors
17636029 HTATIP acts as a negative regulator of Notch1 signaling by means of acetylation.
17604336 These studies suggest that Notch inhibition can initiate aberrant mitosis by inducing NF-kappaB activity that inappropriately increases cyclin B1 resulting in cell death via mitotic catastrophe.
17573339 NOTCHES N1, N2, and N3 all bound to FIH; results suggest the possibility that Notch ICDs are FIH substrates.
17560996 Data suggest that the aberrantly high Notch1 signaling in T-ALL maintains SKP2 at a high level and reduces p27Kip1, leading to more rapid cell cycle progression.
17513037 an important relationship exists between zinc and the Notch1 signaling pathway, and that this relationship is intimately involved with the cytoplasmic retention of Notch and RBP-Jk
17497677 Pathways of signaling by S100A4, by its interaction with and sequestration of p53, and by Notch also seem differentially operational in the induction of apoptosis
17434929 Transcription factor Ying Yang 1 (YY1) indirectly regulates the C promoter-binding factor 1 (CBF1)-dependent Notch1 signaling via direct interaction with the Notch1 receptor.
17425682 Notch1 signaling may participate in the development of human cervical carcinoma cells, but overexpressed active Notch1 inhibits their growth through induction of cell cycle arrest.
17404512 Notch1 mediates T cell and epithelial cell transformation at least in part by sustaining c-Myc levels.
17392684 Notch-1 was found to be expressed in the limbal basal region where stem cells reside
17368826 Notch1 intracellular domain plays the role of a negative regulator in AICD signaling via the disruption of the AICD-Fe65-Tip60 trimeric complex.
17353266 Data demonstrate a novel link between p53 and Notch1 in keratinocyte differentiation upon genotoxic stress and suggest a novel tumor suppressor mechanism of p53 in the development of HPV-induced tumors.
17344417 findings report that the Notch1 gene is a p53 target in human keratinocytes with a role in tumor suppression of this cell type through negative regulation of the ROCK1/2 and MRCKalpha kinases
17317671 MAML1 has a coactivator function for p53, independent of its function as a coactivator of Notch signaling pathway
17316355 NF-kappaB inhibition may contribute partially to cell cycle arrest and apoptosis induced by Notch1 activation in human cervical cancer cells.
17309564 RNA interference of PS1 or Notch1 can block Notch signaling and consequently induce growth inhibition of HeLa cells.
17301032 with supervised resistance exercise training, expression of Notch1 and Hes6 genes were increased and Delta-like 1 and Numb expression were decreased.
17284587 A number of Notch-regulated targets are characterized by paired CSL-binding sites in a head-to-head arrangement; cooperative formation of dimeric Notch transcription complexes on promoters with paired sites is required to activate transcription
17252014 Notch1 transgenes causes T-cell leukemia in zebrafish. Leukemia onset was dramatically accelerated in fish overexpressing bcl-2, indicating synergy between the Notch pathway and the bcl2-mediated antiapoptotic pathway.
17186020 Notch signaling downregulated p53-dependent apoptosis induced by ultraviolet irradiation.
17114293 identify c-MYC as an essential mediator of NOTCH1 signaling and integrate NOTCH1 activation with oncogenic signaling pathways upstream of c-MYC
17107915 This is the first paper to present an acute myeloid leukemia case with NOTCH1 mutation
17090547 Medullary thyroid cancer cell growth inhibition by NOTCH1 is mediated by cell cycle arrest associated with up-regulation of p21.
17046738 Constitutive expression of the activated Notch1 intracellular domain in male reproductive organs of transgenic mice leads to sterility.
17028268 These observations provide further support for a role for Notch-1 signaling in regulating pulmonary neuroendocrine cell differentiation.
17008890 The presence of NOTCH1 mutations in myeloid and T-lymphoid clones in lineage switch leukemias establishes the common clonal origin of the diagnostic and relapse blast populations and suggests a stem cell origin of NOTCH1 mutations
16990763 Notch signaling is essential to open the T-cell pathway, but does not initiate the T-cell program itself
16951331 Notch1 and IL-7 receptor pathways cooperate to synchronize cell proliferation and suppression of non-T lineage choices in primitive intrathymic progenitors.
16887975 Transgenic intracellular Notch1 and C-terminal-deleted Notch1 mutant molecules behave collaboratively as oncogenes for T cells; these mice may represent relevant models of human T-cell leukemias.
16880534 These studies indicate that WSSSSP (S4) sequence of Notch1 is an important negative regulatory sequence and that the deletion of S4 likely contributes to the development of human T-cell Acute Lymphoblastic Leukemia.
16871543 The functional role of AAH in relation to cell motility has been linked to increased activation of the Notch signaling pathway.
16822655 Plays a regulatory role in mesodermal development, cardiomyogenesis, the balanced generation of endothelial versus mural cells of blood vessels and hematopoietic development.
16785210 Full-length expressed WWP1 could interact in vitro with the cytoplasmic domain of human Notch1, which also regulate the nuclear localization of WWP1.
16738328 effect of 16 putative tumor-associated mutations on Notch1 signaling and heterodimerization domain stability
16729972 NOTCH1 gene mutations do not only play a role in familiar bicuspid aortic valve, but can also be observed in approximately 4% of sporadic cases.
16707600 Observational study of gene-disease association. (HuGE Navigator)
16707600 NOTCH1 mutations participate in the pathogenesis of T-ALL, providing a promising rationale for targeted therapies that interfere with NOTCH signaling pathway
16688224 the CUTLL1 cell line has a strong dependence on NOTCH1 signaling for proliferation and survival
16651424 Notch overexpression inhibits p53 induced apoptosis by activating mTOR signaling. Notch, thus makes cancer cells resistant to p53 dependent chemotherapy. Combination chemotherapy of p53 inducers and rapamycin was proved successful at the cell line level.
16622004 Notch up-regulation and subsequent signaling following macrophage activation modulate gene expression patterns known to affect the function of mature macrophages
16618808 p63 expression is suppressed by Notch1 activation in both mouse and human keratinocytes through a mechanism independent of cell cycle withdrawal
16608439 Results demonstrate that constitutively over-expressed active Notch1 resulted in growth suppression of the tongue cancer cell line Tca8113 in vitro and in vivo, accompanied by G(0)-G(1) cell cycle arrest and apoptosis.
16536739 Results suggest that intracellular domains of Notch and amyloid precursor protein are generated by gamma-secretase at the plasma membrane and/or early endosomes.
16530044 Results report the crystal structure of a Notch transcriptional activation complex containing the ankyrin domain of human Notch1, the transcription factor CSL on cognate DNA, and a polypeptide from the coactivator Mastermind-like-1 (MAML-1).
16507111 Cellular responsiveness to Notch signals depends on the activity of the PI3K-Akt pathway in cells as diverse as CHO cells, primary T-cells and hippocampal neurons.
16449526 Notch1 is an important "second hit" for the transformation of E2A deficient T cell lymphomas.
16434391 release of Abeta- or Nbeta-like peptides is a common feature of the proteolysis during regulated intramembrane proteolysis signaling
16378632 dominant-negative forms of c-Myc block transformation by activated Notch1, E6 and E7, suggesting that c-Myc is required for HPV16-mediated transformation
16365048 Notch protein binding to Hes5-GFP is extinguished fast and recovered slowly, whereas Hes1-GFP is inhibited late and recovered quickly
16322473 HES-1 alone is not able to substitute for Notch-1 signaling to induce T-cell differentiation of human CD34+ hematopoietic stem cells.
16317090 DL1-induced activation of the Notch1 pathway controls the lineage commitment of early thymic precursors by altering the levels between Spi-B and GATA-3.
16298817 Acute T-cell lymphoblastic leukemias and lymphomas (T-ALL) have gain-of-function mutations in NOTCH1.
16287852 a corepressor complex containing CtIP/CtBP facilitates RBP-Jkappa/SHARP-mediated repression of Notch target genes
16239965 Data suggest a beta-catenin-dependent, stage-specific role for Notch1 signaling in promoting the progression of primary melanoma.
16179393 Notch1-IC negatively regulates the JNK pathway by disrupting the scaffold function of c-Jun N-terminal kinase (JNK)-interacting protein 1.
16160079 manipulation of the Notch1 signaling pathway may be useful for expanding the targets for therapeutic and palliative treatment of patients with carcinoid tumors
16136053 Decreased Notch 1 mRNA is associated with ovarian adenocarcinomas compared with adenomas
16096376 Notch-1 can participate in cross-talk with other signaling pathways such as Ras/Raf/MEK/ERK through the regulation of the phosphatase and tensin homolog tumor suppressor
16079893 Mutations of the Notch1 gene is associated with T-cell acute lymphoblastic leukemia
16025100 mutations in the signalling and transcriptional regulator NOTCH1 cause a spectrum of developmental aortic valve anomalies and severe valve calcification in non-syndromic autosomal-dominant human pedigrees
16011479 The crystal structure of human Notch 1, including its homology to Drosophila and other species, is reported.
15987768 Notch promotes changes in hVSMC phenotype via activation of CBF-1/RBP-Jkappa-dependent pathways in vitro and contributes to the phenotypic response of VSMCs to cyclic strain-induced changes in VSMC differentiation.
15976178 density of Notch ligands in different organ systems may be an important determinant in regulating cell-fate outcomes
15904468 Notch oncoproteins promote cell growth and cancer development partly by suppressing the growth inhibitory effects of TGF-beta through sequestrating p300 from Smad3
15824732 Pak1-SHARP interaction plays an essential role in enhancing the corepressor functions of SHARP, thereby modulating Notch1 signaling in human cancer cells.
15817159 Notch1 signaling was found to cause growth suppression of HPV-positive cervical cancer cells.
15781650 Down-regulation of Notch-1, Delta-like-1, or Jagged-1 by RNA interference induces apoptosis and inhibits proliferation in multiple glioma cell lines.
15774577 Notch1 protein is used reiteratively and cell-autonomously by endothelial cells to regulate vessel diameter, to limit branching at the tip of sprouts
15756589 From 9q34 known genes, NOTCH1 could thus be the primary target of genomic DNA amplification in enteropathy-type t-cell lymphoma.
15650752 Notch1 fragments generated by caspase cleavage cannot inhibit apoptosis in a T-cells, confirming the abrogation of Notch1 antiapoptotic activity by caspases.
15563588 Active gamma-secretase is present in the plasma membrane. Notch is processed at the cell surface and the majority of APP is processed by intracellular gamma-secretase
15563463 Notch1 inhibits the development of erythroid/megakaryocytic cells by suppressing GATA-1 activity through HES1
15492845 Notch-1 may possess tumour-promoting functions in breast cancer.
15492044 the Numb/Notch biological antagonism has a role in homeostasis of the normal mammary parenchyma and its subversion contributes to human mammary carcinogenesis
15485896 two contiguous regions of noncovalently associated extracellular impose crucial restraints that prevent premature Notch receptor activation
15472075 more than 50% of T cell acute lymphoblastic leukemias, including tumors from all major molecular oncogenic subtypes, have activating mutations involving the extracellular heterodimerization domain and/or the C-terminal PEST domain of NOTCH1
15448134 ligand-induced reversal of controlled TMD dimerization by the Notch extracellular domain is unlikely to underlie the regulatory mechanism of intramembranous cleavage
15280477 upregulated in Papillomavirus-mediated cervical neoplasia and its activation is Jagged1 dependent.
15240571 monoubiquitination and endocytosis of Notch are a prerequisite for its presenilin-dependent cleavage
15213460 NMR assignment of human Notch-1 calcium binding EGF domains 11-13
15058751 Notch1 gene is involved in the differentiation and leukemogenesis in ATRA-modulated process in acute promyelocytic leukemia.
15044485 transcriptional transactivation by APP and Notch may involve distinct mechanisms; whereas the Notch intracellular domain directly functions in the nucleus, the AICD acts indirectly by activating Fe65
14996707 Notch1 gene expression was decreased 5-fold in osteopontin-treated CD34+ cells
14762442 NOTCH1 intracellular domain was found in a human malignant peripheral nerve sheath Schwann cell, indicative of ongoing Notch signaling.
14726396 Notch receptors 1&2 and their ligand Jagged1 are highly expressed in cultured and primary MM cells, suggesting Notch signaling is involved in the tight interactions between neoplastic plasma cells and their bone marrow microenvironment
14678992 Notch1 signaling may participate in the development of hepatocellular carcinoma cells, affecting multiple pathways that control both cell proliferation and apoptosis.
14670925 activation of only Notch-1, but not Notch-2, resulted in protection of tumor cells from melphalan- and mitoxantrone-induced apoptosis. This protection was associated with up-regulation of p21(WAF/Cip) and growth inhibition of cells.
14645224 Notch-1-mediated repression of activator protein-1 requires C promoter-binding factor 1
14602722 notch and erks have roles in prostate cancer bone metastases
12960155 Notch activation directly engages gamma-secretase and subsequently leads to diminished PS1 expression, suggesting a complex set of feedback interactions following Notch activation
12913000 The ankyrin domain of Notch1 receptor (N1IC) and zinc finger domains of YY1 were essential for the association of N1IC and YY1, which were both present in a large complex of the nucleus to suppress activity transactivated by Notch signaling
12829602 regulation of Notch1 activity at defined developmental windows is essential to control alphabeta versus gammadelta T-cell development and to avoid deregulated expansion of alphabeta-lineage cells.
12781689 The NOTCH signalling pathway regulates the basal layer of interfollicular epidermis clusters by controlling stem cell differentiation on the periphery of the clusters.
12768030 inhibits p53-induced apoptosis and transactivation of PI3K-PKB/Akt pathway for HPV16 E6 and E7 cell transformation
12532332 Data show that Notch1 signalling is differentially regulated in T-acute lymphoblastic leukaemia (ALL) and B-lymphoma cells.
12527910 requirement for growth of SV40-transformed mesothelial cells
12509463 Notch1 is required for transcriptional coactivator recruitment and cell growth in tumor cell lines
12482957 We show here that vascular endothelial growth factor but not basic fibroblast growth factor can induce gene expression of Notch1 and Dll4, in human arterial endothelial cells. The VEGF-induced specific signaling is mediated through VEGF receptors 1 and 2
12370358 Activation of Notch-1 signaling promotes the maturation of monocyte-derived dendritic cells.
12357247 These data are the first to implicate the Notch pathway in the limited remyelination in multiple sclerosis.
12208848 exerts specific protective effects against HPV-induced transformation through suppression of E6/E7 expression, and down-modulation of Notch1 expression is likely to play an important role in late stages of HPV-induced carcinogenesis
12145413 Expression of constitutively active recombinant human Notch1 proteins decreased neurite length and number after NGF treatment.
12065598 acid alpha-glucosidase gene is a novel target of the Notch-1/Hes-1 signaling pathway
12048239 presenilin-1 mutation of leu 166 affects generation independent of its effect on Abeta42 production
11978185 Notch signalling involved in differentiation of normal adult human epidermis is altered under experimental conditions and pathologies which modify this program.
11964309 Activated Notch1 signaling promotes tumor cell proliferation and survival in Hodgkin and anaplastic large cell lymphoma
11940670 Notch signaling induces rapid degradation of achaete-scute homolog 1
11848684 Notch dysregulation may contribute to the neuritic dystrophy characteristically seen in Alzheimer's disease brain.
11836628 expressed in human osteoblastic cells and that the expression is differentially regulated upon stimulation with osteogenic factors

AA Sequence

MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKN      1 - 70
AGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQ     71 - 140
ADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATH    141 - 210
TGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYN    211 - 280
CRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATC    281 - 350
HDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA    351 - 420
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVN    421 - 490
TDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTG    491 - 560
THCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCL    561 - 630
KGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGF    631 - 700
TCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKD    701 - 770
MTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN    771 - 840
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDD    841 - 910
CRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHC    911 - 980
ENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQG    981 - 1050
YTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGG   1051 - 1120
LCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSH   1121 - 1190
PCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV   1191 - 1260
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTAR   1261 - 1330
GFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQ   1331 - 1400
GTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNH   1401 - 1470
ACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHF   1471 - 1540
SDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDA   1541 - 1610
HGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI   1611 - 1680
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFV   1681 - 1750
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLET   1751 - 1820
KKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIASC   1821 - 1890
SGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNM   1891 - 1960
GRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKS   1961 - 2030
ALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI   2031 - 2100
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGLACGS   2101 - 2170
KEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDT   2171 - 2240
HLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVASGTSTVLGSSSGGALNFTVGGSTSLNGQCEW   2241 - 2310
LSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLV   2311 - 2380
QTQQVQPQNLQMQQQNLQPANIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSS   2381 - 2450
LAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW   2451 - 2520
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK                                      2521 - 2555
//

Text Mined References (908)

PMID Year Title
27117272 2016 In vivo Wnt pathway inhibition of human squamous cell carcinoma growth and metastasis in the chick chorioallantoic model.
27048872 2016 GATA3 induces human T-cell commitment by restraining Notch activity and repressing NK-cell fate.
26967479 2016 Synchronized Targeting of Notch and ERBB Signaling Suppresses Melanoma Tumor Growth through Inhibition of Notch1 and ERBB3.
26943148 2016 Notch Signaling in Meibomian Gland Epithelial Cell Differentiation.
26921446 2016 Stroma-induced Jagged1 expression drives PC3 prostate cancer cell migration; disparate effects of RIP-generated proteolytic fragments on cell behaviour and Notch signaling.
26870802 2015 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling.
26837467 2016 Autophagy regulates Notch degradation and modulates stem cell development and neurogenesis.
26766164 2016 Advances in aortic disease management: a year in review.
26765751 2016 Synthetic Human NOTCH1 EGF Modules Unraveled Molecular Mechanisms for the Structural and Functional Roles of Calcium Ions and O-Glycans in the Ligand-Binding Region.
26759717 2016 Genomic analyses reveal FAM84B and the NOTCH pathway are associated with the progression of esophageal squamous cell carcinoma.
26744411 2016 A Disintegrin and Metalloproteinase Domain 17 Regulates Colorectal Cancer Stem Cells and Chemosensitivity Via Notch1 Signaling.
26742429 2016 miR-935 suppresses gastric signet ring cell carcinoma tumorigenesis by targeting Notch1 expression.
26716415 2016 Regulation of the epithelial to mesenchymal transition and metastasis by Raf kinase inhibitory protein-dependent Notch1 activity.
26670666 2016 Comprehensive Genomic Profiling of Advanced Penile Carcinoma Suggests a High Frequency of Clinically Relevant Genomic Alterations.
26648098 2016 Theaflavin-3, 3'-digallate decreases human ovarian carcinoma OVCAR-3 cell-induced angiogenesis via Akt and Notch-1 pathways, not via MAPK pathways.
26646450 2015 Activation of an endothelial Notch1-Jagged1 circuit induces VCAM1 expression, an effect amplified by interleukin-1?.
26599017 2015 Increased Notch Signaling Enhances Radioresistance of Malignant Stromal Cells Induced by Glioma Stem/ Progenitor Cells.
26592459 2016 The Notch intracellular domain integrates signals from Wnt, Hedgehog, TGF?/BMP and hypoxia pathways.
26552708 2015 Endothelial NOTCH1 is suppressed by circulating lipids and antagonizes inflammation during atherosclerosis.
26547035 2016 NOTCH1 intracellular domain negatively regulates PAK1 signaling pathway through direct interaction.
26530164 2016 Hepatitis B virus X protein activates Notch signaling by its effects on Notch1 and Notch4 in human hepatocellular carcinoma.
26522984 2015 The PIAS-like Coactivator Zmiz1 Is a Direct and Selective Cofactor of Notch1 in T Cell Development and Leukemia.
26522918 2016 Notch1 endocytosis is induced by ligand and is required for signal transduction.
26518891 2015 Association of NOTCH with different microRNAs in head and neck cancer.
26503358 2015 Caveolin-1 mediates chemoresistance in cisplatin-resistant ovarian cancer cells by targeting apoptosis through the Notch-1/Akt/NF-?B pathway.
26496776 2016 Role of CSL-dependent and independent Notch signaling pathways in cell apoptosis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491050 2016 Inhibition of Notch signaling pathway attenuates sympathetic hyperinnervation together with the augmentation of M2 macrophages in rats post-myocardial infarction.
26471266 2015 DLL4/Notch1 and BMP9 Interdependent Signaling Induces Human Endothelial Cell Quiescence via P27KIP1 and Thrombospondin-1.
26469969 2015 Inhibition of Notch1 signaling overcomes resistance to the death ligand Trail by specificity protein 1-dependent upregulation of death receptor 5.
26464664 2015 KRT6 interacting with notch1 contributes to progression of renal cell carcinoma, and aliskiren inhibits renal carcinoma cell lines proliferation in vitro.
26460922 2016 Clinicopathological significance of Notch1 expression in cervical cancer patients: a meta-analysis.
26426381 2016 NOTCH1, TP53, and MAP2K1 Mutations in Splenic Diffuse Red Pulp Small B-cell Lymphoma Are Associated With Progressive Disease.
26416455 2015 TQ inhibits hepatocellular carcinoma growth in vitro and in vivo via repression of Notch signaling.
26406415 2015 Immunohistochemical expression of Notch1, Jagged1, NF-?B and MMP-9 in colorectal cancer patients and the relationship to clinicopathological parameters.
26398771 2015 Downregulation of Notch1 induces apoptosis and inhibits cell proliferation and metastasis in laryngeal squamous cell carcinoma.
26398566 2015 Loss of function of Notch1 identifies a poor prognosis group of early stage hepatocellular carcinoma following hepatectomy.
26394830 2015 Angiogenesis-related protein expression in bevacizumab-treated metastatic colorectal cancer: NOTCH1 detrimental to overall survival.
26361419 2015 Notch1 downregulation combined with interleukin-24 inhibits invasion and migration of hepatocellular carcinoma cells.
26341090 2016 Characterization of Notch Signalling Pathway Members in Normal Prostate, Prostatic Intraepithelial Neoplasia (PIN) and Prostatic Adenocarcinoma.
26330272 2015 LncRNA NALT interaction with NOTCH1 promoted cell proliferation in pediatric T cell acute lymphoblastic leukemia.
26307032 2015 Aberrant expression of Notch1/numb/snail signaling, an epithelial mesenchymal transition related pathway, in adenomyosis.
26302069 2015 Notch1 Pathway Activation Results from the Epigenetic Abrogation of Notch-Related MicroRNAs in Mycosis Fungoides.
26299922 2015 MiR-139-5p inhibits the biological function of breast cancer cells by targeting Notch1 and mediates chemosensitivity to docetaxel.
26294213 2015 Notch1 Activation or Loss Promotes HPV-Induced Oral Tumorigenesis.
26281688 2015 [Novel signal transduction pathways: the molecular basis for targeted cancer therapies in Hedgehog/Notch/Wnt pathway].
26235278 2015 Notch pathway promotes ovarian cancer growth and migration via CXCR4/SDF1? chemokine system.
26206887 2015 Lyso-Gb3 activates Notch1 in human podocytes.
26176534 2015 Pro-Inflammatory Cytokine IL-1? Up-Regulates CXC Chemokine Receptor 4 via Notch and ERK Signaling Pathways in Tongue Squamous Cell Carcinoma.
26165719 2015 A functional polymorphism in the pre?miR?146a gene influences the prognosis of glioblastoma multiforme by interfering with the balance between Notch1 and Notch2.
26165233 2016 NOTCH1 mutations associate with low CD20 level in chronic lymphocytic leukemia: evidence for a NOTCH1 mutation-driven epigenetic dysregulation.
26164125 2015 Compound heterozygous NOTCH1 mutations underlie impaired cardiogenesis in a patient with hypoplastic left heart syndrome.
26161746 2015 IRF6 Is Involved in the Regulation of Cell Proliferation and Transformation in MCF10A Cells Downstream of Notch Signaling.
26152787 2016 A NOTCH1 gene copy number gain is a prognostic indicator of worse survival and a predictive biomarker to a Notch1 targeting antibody in colorectal cancer.
26121683 2015 Expression of Notch1 Correlates with Breast Cancer Progression and Prognosis.
26070613 2015 Expression levels of Notch1 and Delta-like 4 in peripheral lymphocytes and their relationship with T helper 17 (Th17) cells in renal transplant recipients.
26062426 2015 [IL-23 promotes invasion of esophageal squamous cell carcinoma cells by activating DLL4/Notch1 signaling pathway].
26045779 2015 Involvement of Notch1/Hes signaling pathway in ankylosing spondylitis.
26041884 2015 Notch signaling sustains the expression of Mcl-1 and the activity of eIF4E to promote cell survival in CLL.
26033683 2015 p53 Modulates Notch Signaling in MCF-7 Breast Cancer Cells by Associating With the Notch Transcriptional Complex Via MAML1.
26023825 2015 Notch Transmembrane Domain: Secondary Structure and Topology.
26014475 2015 Alteration of Delta-like ligand 1 and Notch 1 receptor in various placental disorders with special reference to early onset preeclampsia.
25990317 2015 Notch-1 knockdown suppresses proliferation, migration and metastasis of salivary adenoid cystic carcinoma cells.
25979380 2015 Notch1 pathway in adrenocortical carcinomas: correlations with clinical outcome.
25963903 2015 Targeting of miR9/NOTCH1 interaction reduces metastatic behavior in triple-negative breast cancer.
25963545 2015 Haploinsufficiency of the NOTCH1 Receptor as a Cause of Adams-Oliver Syndrome With Variable Cardiac Anomalies.
25920606 2015 Interference of Notch1 inhibits the growth of glioma cancer cells by inducing cell autophagy and down-regulation of Notch1-Hes-1 signaling pathway.
25914224 2015 Notch-1 promotes stemness and epithelial to mesenchymal transition in colorectal cancer.
25903338 2015 Human Cytomegalovirus Infection Dysregulates the Localization and Stability of NICD1 and Jag1 in Neural Progenitor Cells.
25895060 2015 Notch is a direct negative regulator of the DNA-damage response.
25887885 2015 Xanthohumol-Mediated Suppression of Notch1 Signaling Is Associated with Antitumor Activity in Human Pancreatic Cancer Cells.
25879451 2015 Targeting Notch1 and proteasome as an effective strategy to suppress T-cell lymphoproliferative neoplasms.
25871831 2015 NOTCH1 regulates matrix gla protein and calcification gene networks in human valve endothelium.
25869878 2015 Coexpression of c-Met and Notch-1 correlates with poor prognosis in resected non-small-cell lung cancer.
25849484 2015 Potential role of Notch signalling in CD34+ chronic myeloid leukaemia cells: cross-talk between Notch and BCR-ABL.
25846406 2015 Notch receptor expression in human brain arteriovenous malformations.
25845347 2015 OSM is overexpressed in knee osteoarthritis and Notch signaling is involved in the effects of OSM on MC3T3-E1 cell proliferation and differentiation.
25842263 2015 Notch1 ligand signaling pathway activated in cervical cancer: poor prognosis with high-level JAG1/Notch1.
25825216 2015 Vehicular exhaust particles promote allergic airway inflammation through an aryl hydrocarbon receptor-notch signaling cascade.
25802929 2015 Folates Induce Colorectal Carcinoma HT29 Cell Line Proliferation Through Notch1 Signaling.
25796442 2015 PLC? knockdown inhibits prostate cancer cell proliferation via suppression of Notch signalling and nuclear translocation of the androgen receptor.
25786252 2015 Insulin growth factor 1 receptor expression is associated with NOTCH1 mutation, trisomy 12 and aggressive clinical course in chronic lymphocytic leukaemia.
25786100 2015 Migration of smooth muscle cells from the arterial anastomosis of arteriovenous fistulas requires Notch activation to form neointima.
25783790 2015 MicroRNA-34a suppresses the breast cancer stem cell-like characteristics by downregulating Notch1 pathway.
25768904 2015 Human disease modeling reveals integrated transcriptional and epigenetic mechanisms of NOTCH1 haploinsufficiency.
25759215 2015 Lysyl oxidase-like 2 represses Notch1 expression in the skin to promote squamous cell carcinoma progression.
25747658 2015 A tail of two sites: a bipartite mechanism for recognition of notch ligands by mind bomb E3 ligases.
25744722 2015 Notch suppresses angiogenesis and progression of hepatic metastases.
25744398 2015 Combining detection of Notch1 and tumor necrosis factor-? converting enzyme is a reliable biomarker for the diagnosis of abdominal aortic aneurysms.
25723053 2015 Human papillomavirus 16E6 and NFX1-123 potentiate Notch signaling and differentiation without activating cellular arrest.
25714926 2015 Angiopoietin-like proteins stimulate HSPC development through interaction with notch receptor signaling.
25704190 2015 Elevated expression of Notch-1 and EGFR induced apoptosis in glioblastoma multiforme patients.
25700162 2015 Activation of NOTCH1 or NOTCH3 signaling skews human airway basal cell differentiation toward a secretory pathway.
25667444 2015 GLI1, CTNNB1 and NOTCH1 protein expression in a thymic epithelial malignancy tissue microarray.
25667199 2015 Epidermal growth factor-like domain 7 promotes migration and invasion of human trophoblast cells through activation of MAPK, PI3K and NOTCH signaling pathways.
25665548 2015 Effect of Notch expression in glioma stem cells on therapeutic response to chemo-radiotherapy in recurrent glioblastoma.
25653136 2015 Notch1 phenotype and clinical stage progression in non-small cell lung cancer.
25645984 2015 Implications of the Notch1-Snail/Slug-epithelial to mesenchymal transition axis for lymph node metastasis in infiltrating ductal carcinoma.
25645291 2015 Notch1 signaling regulates the epithelial-mesenchymal transition and invasion of breast cancer in a Slug-dependent manner.
25637217 2015 Role of stromal cells-mediated Notch-1 in the invasion of T-ALL cells.
25633905 2015 Constitutive activation of NF-?B signaling by NOTCH1 mutations in chronic lymphocytic leukemia.
25633867 2015 Cleaved NOTCH1 Expression Pattern in Head and Neck Squamous Cell Carcinoma Is Associated with NOTCH1 Mutation, HPV Status, and High-Risk Features.
25623554 2015 Breast cancer cells promote a notch-dependent mesenchymal phenotype in endothelial cells participating to a pro-tumoral niche.
25611897 2015 Increased Notch1 expression is associated with poor overall survival in patients with ovarian cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25608512 2015 KSR1 is coordinately regulated with Notch signaling and oxidative phosphorylation in thyroid cancer.
25605254 2015 Frequencies of SF3B1, NOTCH1, MYD88, BIRC3 and IGHV mutations and TP53 disruptions in Chinese with chronic lymphocytic leukemia: disparities with Europeans.
25587027 2014 The p53 transcriptional pathway is preserved in ATMmutated and NOTCH1mutated chronic lymphocytic leukemias.
25574842 2015 NOTCH pathway inactivation promotes bladder cancer progression.
25547411 2014 Identifying tandem Ankyrin repeats in protein structures.
25544568 2015 Notch1 induces epithelial-mesenchymal transition and the cancer stem cell phenotype in breast cancer cells and STAT3 plays a key role.
25517959 2015 NOTCH1 intracellular domain immunohistochemistry as a diagnostic tool to distinguish T-lymphoblastic lymphoma from thymoma.
25512468 2015 Loss of the Notch effector RBPJ promotes tumorigenesis.
25493453 2015 NOTCH1 and FBXW7 mutations favor better outcome in pediatric South Indian T-cell acute lymphoblastic leukemia.
25479589 2015 The Notch intracellular domain represses CRE-dependent transcription.
25456735 2014 Notch1 controls cell invasion and metastasis in small cell lung carcinoma cell lines.
25425968 2014 Galectin-3 inhibits osteoblast differentiation through notch signaling.
25425197 2015 Constitutive phosphorylation of the active Notch1 intracellular domain in chronic lymphocytic leukemia cells with NOTCH1 mutation.
25420528 2014 Correlation and prognostic value of SIRT1 and Notch1 signaling in breast cancer.
25418282 2015 Nicotine exposure alters the mRNA expression of Notch ligands in dendritic cells and their response to Th1-/Th2-promoting stimuli.
25406187 2015 Notch1 mutations are drivers of oral tumorigenesis.
25400232 2014 Multifunctional core/shell nanoparticles cross-linked polyetherimide-folic acid as efficient Notch-1 siRNA carrier for targeted killing of breast cancer.
25385755 2014 Identification of Cdca7 as a novel Notch transcriptional target involved in hematopoietic stem cell emergence.
25381598 2014 MicroRNA expression profiling and Notch1 and Notch2 expression in minimal deviation adenocarcinoma of uterine cervix.
25381127 2015 The NOTCH pathway is recurrently mutated in diffuse large B-cell lymphoma associated with hepatitis C virus infection.
25380486 2014 Endothelial cells provide a notch-dependent pro-tumoral niche for enhancing breast cancer survival, stemness and pro-metastatic properties.
25380126 2014 Severe neonatal presentation of Kleefstra syndrome in a patient with hypoplastic left heart syndrome and 9q34.3 microdeletion.
25377784 2015 Deep sequencing identifies genetic heterogeneity and recurrent convergent evolution in chronic lymphocytic leukemia.
25369933 2014 Long-range enhancer activity determines Myc sensitivity to Notch inhibitors in T cell leukemia.
25368020 2014 Targeting of miR34a-NOTCH1 axis reduced breast cancer stemness and chemoresistance.
25355291 2015 DLL4 regulates NOTCH signaling and growth of T acute lymphoblastic leukemia cells in NOD/SCID mice.
25344755 2014 Cyclin C is a haploinsufficient tumour suppressor.
25344525 2014 The Notch driven long non-coding RNA repertoire in T-cell acute lymphoblastic leukemia.
25337219 2014 Association of Notch1 with vasculogenic mimicry in human hepatocellular carcinoma cell lines.
25316189 2014 let-7 miRNAs can act through notch to regulate human gliogenesis.
25311243 2015 A microRNA-mediated regulatory loop modulates NOTCH and MYC oncogenic signals in B- and T-cell malignancies.
25299773 2014 Notch signaling regulates myogenic regenerative capacity of murine and human mesoangioblasts.
25295490 2014 Concomitant Notch activation and p53 deletion trigger epithelial-to-mesenchymal transition and metastasis in mouse gut.
25278704 2014 Xiaotan Sanjie decoction attenuates tumor angiogenesis by manipulating Notch-1-regulated proliferation of gastric cancer stem-like cells.
25263445 2015 NOTCH1 activation in breast cancer confers sensitivity to inhibition of SUMOylation.
25257945 2014 Synergistic association of Notch and NF?B signaling and role of Notch signaling in modulating epithelial to mesenchymal transition in colorectal adenocarcinoma.
25254944 2014 Sphingosine-1-phosphate promotes expansion of cancer stem cells via S1PR3 by a ligand-independent Notch activation.
25253780 2014 Coordinate hyperactivation of Notch1 and Ras/MAPK pathways correlates with poor patient survival: novel therapeutic strategy for aggressive breast cancers.
25234595 2014 Frequent mutations in NOTCH1 ligand-binding regions in Japanese oral squamous cell carcinoma.
25213258 2015 Oroxylin A induces autophagy in human malignant glioma cells via the mTOR-STAT3-Notch signaling pathway.
25194570 2014 A NOTCH1-driven MYC enhancer promotes T cell development, transformation and acute lymphoblastic leukemia.
25192910 2014 TRPM7 channels regulate glioma stem cell through STAT3 and Notch signaling pathways.
25179844 2014 MicroRNA-449a reduces cell survival and enhances cisplatin-induced cytotoxicity via downregulation of NOTCH1 in ovarian cancer cells.
25176314 2014 Spatial localization of the JAG1/Notch1/osteopontin cascade modulates extrahepatic metastasis in hepatocellular carcinoma.
25149541 2014 NOTCH1 signaling contributes to cell growth, anti-apoptosis and metastasis in salivary adenoid cystic carcinoma.
25149074 2014 MiR-139-5p inhibits migration and invasion of colorectal cancer by downregulating AMFR and NOTCH1.
25141821 2014 Recurrent mutations of NOTCH genes in follicular lymphoma identify a distinctive subset of tumours.
25132448 2014 Mutations in NOTCH1 cause Adams-Oliver syndrome.
25120811 2014 Notch1 single nucleotide polymorphism rs3124591 is associated with the risk of development of invasive ductal breast carcinoma in a Chinese population.
25110169 2014 Downregulation of Notch1 inhibits the invasion of human hepatocellular carcinoma HepG2 and MHCC97H cells through the regulation of PTEN and FAK.
25109409 2014 Notch-1 regulates proliferation and differentiation of human bladder cancer cell lines by inhibiting expression of Krüppel-like factor 4.
25107841 2014 Downregulated protein O-fucosyl transferase 1 (Pofut1) expression exerts antiproliferative and antiadhesive effects on hepatocytes by inhibiting Notch signalling.
25083870 2014 Genome-wide mapping and characterization of Notch-regulated long noncoding RNAs in acute leukemia.
25073953 2014 Colocalization of ?-catenin with Notch intracellular domain in colon cancer: a possible role of Notch1 signaling in activation of CyclinD1-mediated cell proliferation.
25053477 2014 Introduction to Notch signaling.
25050861 2014 Directed differentiation of patient-specific induced pluripotent stem cells identifies the transcriptional repression and epigenetic modification of NKX2-5, HAND1, and NOTCH1 in hypoplastic left heart syndrome.
25041344 2015 Clinical role of Notch signaling pathway in intraductal papillary mucinous neoplasm of the pancreas.
25034654 2015 Activated Notch1 expression is associated with angiogenesis in cutaneous melanoma.
25031748 2014 Clinicopathological significance of aberrant Notch receptors in intrahepatic cholangiocarcinoma.
25017705 2014 Notch1 promotes hepatitis B virus X protein-induced hepatocarcinogenesis via Wnt/?-catenin pathway.
25004243 2014 Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma.
24993241 2014 Increased leukemia-associated gene expression in benzene-exposed workers.
24977325 2014 CD24 regulates stemness and the epithelial to mesenchymal transition through modulation of Notch1 mRNA stability by p38MAPK.
24970818 2014 Visfatin promotes cell and tumor growth by upregulating Notch1 in breast cancer.
24966950 2014 Notch-1 and Ki-67 receptor as predictors for the recurrence and prognosis of Kimura's disease.
24950189 2014 Notch signaling regulates the lifespan of vascular endothelial cells via a p16-dependent pathway.
24931169 2015 Cellular senescence checkpoint function determines differential Notch1-dependent oncogenic and tumor-suppressor activities.
24923451 2014 NOTCH1 mutations identify a chronic lymphocytic leukemia patient subset with worse prognosis in the setting of a rituximab-based induction and consolidation treatment.
24905589 2014 Clinical impact of de-regulated Notch-1 and Notch-3 in the development and progression of HPV-associated different histological subtypes of precancerous and cancerous lesions of human uterine cervix.
24898819 2015 Notch1 stimulation induces a vascularization switch with pericyte-like cell differentiation of glioblastoma stem cells.
24888228 2014 Notch1 signaling controls cell proliferation, apoptosis and differentiation in lung carcinoma.
24885920 2014 microRNA-139-5p exerts tumor suppressor function by targeting NOTCH1 in colorectal cancer.
24878247 2014 Role of notch signaling in the maintenance of human mesenchymal stem cells under hypoxic conditions.
24829201 2014 Trisomy 12 chronic lymphocytic leukemia cells exhibit upregulation of integrin signaling that is modulated by NOTCH1 mutations.
24803430 2014 Fringe-mediated extension of O-linked fucose in the ligand-binding region of Notch1 increases binding to mammalian Notch ligands.
24801890 2014 Loss of Notch1-dependent p21(Waf1/Cip1) expression influences the Notch1 outcome in tumorigenesis.
24789803 2014 Notch1 overexpression associates with poor prognosis in human laryngeal squamous cell carcinoma.
24782036 2014 NOTCH1 signaling promotes chemoresistance via regulating ABCC1 expression in prostate cancer stem cells.
24780321 2014 Correlation of over-expressions of miR-21 and Notch-1 in human colorectal cancer with clinical stages.
24768363 2015 Differential expression of Hedgehog/Notch and transforming growth factor-? in human abdominal aortic aneurysms.
24755984 2014 Notch pathway targets proangiogenic regulator Sox17 to restrict angiogenesis.
24743148 2014 Multifactorial ER? and NOTCH1 control of squamous differentiation and cancer.
24728738 2014 Nuclear Notch3 expression is associated with tumor recurrence in patients with stage II and III colorectal cancer.
24727675 2014 An aberrant microRNA signature in childhood T-cell lymphoblastic lymphoma affecting CDKN1B expression, NOTCH1 and growth factor signaling pathways.
24726647 2014 Activation of Notch1 promotes development of human CD8(+) single positive T cells in humanized mice.
24710932 2014 Effects of Notch-1 down-regulation on malignant behaviors of breast cancer stem cells.
24700253 2014 Notch1 is overexpressed in human intrahepatic cholangiocarcinoma and is associated with its proliferation, invasiveness and sensitivity to 5-fluorouracil in vitro.
24695418 2014 Hyperexpression of NOTCH-1 is found in immature acute myeloid leukemia.
24690100 2014 NOTCH1 mutations are associated with favourable long-term prognosis in paediatric T-cell acute lymphoblastic leukaemia: a retrospective study of patients treated on BCH-2003 and CCLG-2008 protocol in China.
24684482 2014 Notch1 increases Snail expression under high reactive oxygen species conditions in hepatocellular carcinoma cells.
24671051 2014 ALDH maintains the stemness of lung adenoma stem cells by suppressing the Notch/CDK2/CCNE pathway.
24662767 2014 NOTCH1 mutations occur early during cutaneous squamous cell carcinogenesis.
24659709 2014 Epigenetic silencing of microRNA-199b-5p is associated with acquired chemoresistance via activation of JAG1-Notch1 signaling in ovarian cancer.
24652989 2014 Gene mutations and treatment outcome in chronic lymphocytic leukemia: results from the CLL8 trial.
24642622 2014 Notch1 activation is a poor prognostic factor in patients with gastric cancer.
24628678 2014 The deposition of Notch1 in hepatitis B virus-associated nephropathy and its role in hepatitis B virus X protein-induced epithelial-mesenchymal transdifferentiation and immunity disorder in renal tubular epithelial cells.
24560443 2014 Immunohistochemical expression of aberrant Notch-1 signaling in vitiligo: an implication for pathogenesis.
24492617 2014 Noncanonical activation of Notch1 protein by membrane type 1 matrix metalloproteinase (MT1-MMP) controls melanoma cell proliferation.
24489102 2014 Involvement of Notch in activation and effector functions of ?? T cells.
24474689 2014 Alteration of mitochondrial proteome due to activation of Notch1 signaling pathway.
24469571 2014 Notch1 silencing inhibits proliferation and invasion in SGC?7901 gastric cancer cells.
24453806 2013 Blockage of Notch signaling inhibits the migration and proliferation of retinal pigment epithelial cells.
24446471 2014 Increased Notch pathway activation in Behçet's disease.
24424791 2014 Prognostic implications of mutations in NOTCH1 and FBXW7 in childhood T-ALL treated according to the NOPHO ALL-1992 and ALL-2000 protocols.
24424521 2014 Mouse and human Notch-1 regulate mucosal immune responses.
24423157 2013 Expression of Notch-1 and its clinical significance in different histological subtypes of human lung adenocarcinoma.
24418111 Variants in the NOTCH1 gene in patients with aortic coarctation.
24415757 2014 Novel regulation of CD80/CD86-induced phosphatidylinositol 3-kinase signaling by NOTCH1 protein in interleukin-6 and indoleamine 2,3-dioxygenase production by dendritic cells.
24406215 2014 Promotion of dentin regeneration via CCN3 modulation on Notch and BMP signaling pathways.
24392017 2013 The MEK/ERK pathway promotes NOTCH signalling in pancreatic cancer cells.
24336972 2014 Notch1 is a potential therapeutic target for the treatment of human hepatitis B virus X protein-associated hepatocellular carcinoma.
24330353 2014 Notch-1 mediates endothelial cell activation and invasion in psoriasis.
24326827 2014 Utility of LRF/Pokemon and NOTCH1 protein expression in the distinction between nodular lymphocyte-predominant Hodgkin lymphoma and classical Hodgkin lymphoma.
24321094 2014 NOTCH1 signaling regulates the BMP2/DLX-3 directed osteogenic differentiation of dental follicle cells.
24308033 2013 The matricellular protein CCN3 regulates NOTCH1 signalling in chronic myeloid leukaemia.
24305720 2014 Differential patterns of NOTCH1-4 receptor expression are markers of glioma cell differentiation.
24281414 2013 miR-200b suppresses cell growth, migration and invasion by targeting Notch1 in nasopharyngeal carcinoma.
24277457 2014 Common and complex Notch1 mutations in Chinese oral squamous cell carcinoma.
24260356 2013 An aquaporin 3-notch1 axis in keratinocyte differentiation and inflammation.
24249312 2014 Identification of novel NOTCH1 mutations: increasing our knowledge of the NOTCH signaling pathway.
24226769 2013 The heterotaxy gene GALNT11 glycosylates Notch to orchestrate cilia type and laterality.
24217574 2013 NOTCH1 expression predicts patient prognosis in esophageal squamous cell cancer.
24216479 2013 Isoprenylcysteine carboxylmethyltransferase deficiency exacerbates KRAS-driven pancreatic neoplasia via Notch suppression.
24204826 2013 Activation of Notch signaling is required for cholangiocarcinoma progression and is enhanced by inactivation of p53 in vivo.
24177259 2014 A revised NOTCH1 mutation frequency still impacts survival while the allele burden predicts early progression in chronic lymphocytic leukemia.
24170027 2014 Functional impact of NOTCH1 mutations in chronic lymphocytic leukemia.
24166518 2013 Toward a NOTCH1/FBXW7/RAS/PTEN-based oncogenetic risk classification of adult T-cell acute lymphoblastic leukemia: a Group for Research in Adult Acute Lymphoblastic Leukemia study.
24151014 2014 Abnormal expression pattern of Notch receptors, ligands, and downstream effectors in the dorsolateral prefrontal cortex and amygdala of suicidal victims.
24141420 2013 Notch1-dependent regulation of p27 determines cell fate in colorectal cancer.
24140581 2014 The genetic landscape of anaplastic astrocytoma.
24140425 2013 MAST2 and NOTCH1 translocations in breast carcinoma and associated pre-invasive lesions.
24122995 2013 NOTCH knockdown affects the proliferation and mTOR signaling of leukemia cells.
24113472 2014 SF3B1 mutations correlated to cytogenetics and mutations in NOTCH1, FBXW7, MYD88, XPO1 and TP53 in 1160 untreated CLL patients.
24113181 2013 The AKT1/NF-kappaB/Notch1/PTEN axis has an important role in chemoresistance of gastric cancer cells.
24109236 2013 NFX1-123 and human papillomavirus 16E6 increase Notch expression in keratinocytes.
24108462 2013 Unraveling a novel transcription factor code determining the human arterial-specific endothelial cell signature.
24095799 2014 Molecular cross talk between Notch1, Shh and Akt pathways during erythroid differentiation of K562 and HEL cell lines.
24024180 2013 Effect of mesenchymal stem cells and a novel curcumin derivative on Notch1 signaling in hepatoma cell line.
24022665 2014 Notch-1-mediated esophageal carcinoma EC-9706 cell invasion and metastasis by inducing epithelial-mesenchymal transition through Snail.
24019071 2013 Noncanonical NOTCH signaling limits self-renewal of human epithelial and induced pluripotent stem cells through ROCK activation.
24010734 2014 Cell-surface Notch1 expression identifies a primitive phenotype within CD34+ CD38- haematopoietic cells.
23999936 2013 Novel MIR143-NOTCH fusions in benign and malignant glomus tumors.
23990360 2013 Hepatic notch signaling correlates with insulin resistance and nonalcoholic fatty liver disease.
23974200 2013 Transcription factor C/EBP?-induced microRNA-30c inactivates Notch1 during granulopoiesis and is downregulated in acute myeloid leukemia.
23938602 2013 The pathological significance of Notch1 in oral squamous cell carcinoma.
23924630 2013 Notch signaling represses p63 expression in the developing surface ectoderm.
23916913 2013 Notch-1 contributes to epidermal growth factor receptor tyrosine kinase inhibitor acquired resistance in non-small cell lung cancer in vitro and in vivo.
23902763 2013 Rhamnetin and cirsiliol induce radiosensitization and inhibition of epithelial-mesenchymal transition (EMT) by miR-34a-mediated suppression of Notch-1 expression in non-small cell lung cancer cell lines.
23899513 2013 Epidermal growth factor regulates NIKS keratinocyte proliferation through Notch signaling.
23893575 2013 Clonal evolution in chronic lymphocytic leukemia: analysis of correlations with IGHV mutational status, NOTCH1 mutations and clinical significance.
23883974 2013 Elevated expression of notch1 is associated with metastasis of human malignancies.
23881612 2014 RECK inhibits stemness gene expression and tumorigenicity of gastric cancer cells by suppressing ADAM-mediated Notch1 activation.
23870033 2014 Downregulation of the endothelial genes Notch1 and ephrinB2 in patients with nodular regenerative hyperplasia.
23860447 2013 Prognostic impact and landscape of NOTCH1 mutations in chronic lymphocytic leukemia (CLL): a study on 852 patients.
23839946 2013 Intrinsic selectivity of Notch 1 for Delta-like 4 over Delta-like 1.
23821658 2013 NOTCH1, SF3B1, and TP53 mutations in fludarabine-refractory CLL patients treated with alemtuzumab: results from the CLL2H trial of the GCLLSG.
23798201 2013 NOTCH1 genetic variants in patients with tricuspid calcific aortic valve stenosis.
23788636 2013 Notch1 receptor regulates AKT protein activation loop (Thr308) dephosphorylation through modulation of the PP2A phosphatase in phosphatase and tensin homolog (PTEN)-null T-cell acute lymphoblastic leukemia cells.
23787764 2013 Implications of Dll4-Notch signaling activation in primary glioblastoma multiforme.
23776410 2013 Fbw7 repression by hes5 creates a feedback loop that modulates Notch-mediated intestinal and neural stem cell fate decisions.
23775982 2014 Jagged1 immobilization to an osteoconductive polymer activates the Notch signaling pathway and induces osteogenesis.
23775085 2013 Increased cAMP in monocytes augments Notch signaling mechanisms by elevating RBP-J and transducin-like enhancer of Split (TLE).
23749167 2013 Thymosin beta4 induces angiogenesis through Notch signaling in endothelial cells.
23743248 2013 Notch activation promotes endothelial survival through a PI3K-Slug axis.
23742774 2013 Notch1 and Notch4 are markers for poor prognosis of hepatocellular carcinoma.
23734977 2013 NOTCH1 mutations influence survival in chronic lymphocytic leukemia patients.
23733784 2013 Therapeutic targeting of NOTCH signaling ameliorates immune-mediated bone marrow failure of aplastic anemia.
23713656 2013 Discovery of (R)-4-cyclopropyl-7,8-difluoro-5-(4-(trifluoromethyl)phenylsulfonyl)-4,5-dihydro-1H-pyrazolo[4,3-c]quinoline (ELND006) and (R)-4-cyclopropyl-8-fluoro-5-(6-(trifluoromethyl)pyridin-3-ylsulfonyl)-4,5-dihydro-2H-pyrazolo[4,3-c]quinoline (ELND007): metabolically stable ?-secretase Inhibitors that selectively inhibit the production of amyloid-? over Notch.
23707238 2013 Angiotensin II contributes to diabetic renal dysfunction in rodents and humans via Notch1/Snail pathway.
23688168 2013 The roles of Notch1 expression in the migration of intrahepatic cholangiocarcinoma.
23671619 2013 Pterostilbene exerts antitumor activity via the Notch1 signaling pathway in human lung adenocarcinoma cells.
23665520 2013 Regulation of innate and adaptive immunity by Notch.
23651443 2013 Inhibition of CK2? down-regulates Notch1 signalling in lung cancer cells.
23645351 2013 Expression of EGFR, VEGF, and NOTCH1 suggest differences in tumor angiogenesis in HPV-positive and HPV-negative head and neck squamous cell carcinoma.
23642368 2013 A microRNA miR-34a-regulated bimodal switch targets Notch in colon cancer stem cells.
23640488 2013 Notch1 promotes the pro-osteogenic response of human aortic valve interstitial cells via modulation of ERK1/2 and nuclear factor-?B activation.
23632994 2013 Knockdown of TRB3 induces apoptosis in human lung adenocarcinoma cells through regulation of Notch 1 expression.
23630292 2013 Genetic deletion of Rnd3 results in aqueductal stenosis leading to hydrocephalus through up-regulation of Notch signaling.
23625115 2013 Targeting oncogene expression to endothelial cells induces proliferation of the myelo-erythroid lineage by repressing the Notch pathway.
23620080 2013 Short telomere length is associated with NOTCH1/SF3B1/TP53 aberrations and poor outcome in newly diagnosed chronic lymphocytic leukemia patients.
23605216 2014 Possible involvement of Notch signaling in the pathogenesis of Buerger's disease.
23603912 2013 Whole-exome sequencing in adult ETP-ALL reveals a high rate of DNMT3A mutations.
23594289 2013 Immunohistochemical analysis of the role and relationship between Notch-1 and Oct-4 expression in urinary bladder carcinoma.
23589494 2013 Notch increases the shedding of HB-EGF by ADAM12 to potentiate invadopodia formation in hypoxia.
23589286 2013 Inflammatory cytokines induce NOTCH signaling in nucleus pulposus cells: implications in intervertebral disc degeneration.
23583836 2013 Endothelial nitric oxide signaling regulates Notch1 in aortic valve disease.
23578328 2013 Sequencing of NOTCH1, GATA5, TGFBR1 and TGFBR2 genes in familial cases of bicuspid aortic valve.
23576735 2013 Genome-wide reprogramming of the chromatin landscape underlies endocrine therapy resistance in breast cancer.
23569274 2013 Notch1 modulates oxidative stress induced cell death through suppression of apoptosis signal-regulating kinase 1.
23568245 2013 Notch1 contributes to chemoresistance to gemcitabine and serves as an unfavorable prognostic indicator in pancreatic cancer.
23558524 2013 Distinct patterns of novel gene mutations in poor-prognostic stereotyped subsets of chronic lymphocytic leukemia: the case of SF3B1 and subset #2.
23542114 2013 Arsenic trioxide depletes cancer stem-like cells and inhibits repopulation of neurosphere derived from glioblastoma by downregulation of Notch pathway.
23533157 2013 Tumorigenic potential of miR-18A* in glioma initiating cells requires NOTCH-1 signaling.
23531595 2013 Chronic lymphocytic leukemia: a clinical and molecular heterogenous disease.
23500524 2013 ShRNA targeting Notch1 sensitizes breast cancer stem cell to paclitaxel.
23468978 2013 The significance of Notch1 compared with Notch3 in high metastasis and poor overall survival in hepatocellular carcinoma.
23455394 2013 Notch signaling in acute promyelocytic leukemia.
23454378 2013 Snail inhibits Notch1 intracellular domain mediated transcriptional activation via competing with MAML1.
23444212 2013 Notch pathway activity identifies cells with cancer stem cell-like properties and correlates with worse survival in lung adenocarcinoma.
23435461 2013 TP53, SF3B1, and NOTCH1 mutations and outcome of allotransplantation for chronic lymphocytic leukemia: six-year follow-up of the GCLLSG CLL3X trial.
23430952 2013 Diallyl trisulfide inhibits proliferation, invasion and angiogenesis of osteosarcoma cells by switching on suppressor microRNAs and inactivating of Notch-1 signaling.
23423517 2013 Notch1-Hes1 signalling axis in the tumourigenesis of biliary neuroendocrine tumours.
23409141 2013 Notch1 is a 5-fluorouracil resistant and poor survival marker in human esophagus squamous cell carcinomas.
23396245 2013 Notch signaling regulates nucleocytoplasmic Olig2 translocation in reactive astrocytes differentiation after ischemic stroke.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23380742 2013 Notch controls generation and function of human effector CD8+ T cells.
23349727 2013 The different role of Notch1 and Notch2 in astrocytic gliomas.
23349303 2013 NOTCH1 activation clinically antagonizes the unfavorable effect of PTEN inactivation in BFM-treated children with precursor T-cell acute lymphoblastic leukemia.
23341344 2013 The molecular profile of adult T-cell acute lymphoblastic leukemia: mutations in RUNX1 and DNMT3A are associated with poor prognosis in T-ALL.
23339193 2013 Molecular basis for Jagged-1/Serrate ligand recognition by the Notch receptor.
23319603 2013 High throughput kinase inhibitor screens reveal TRB3 and MAPK-ERK/TGF? pathways as fundamental Notch regulators in breast cancer.
23300864 2012 No evidence for a functional role of bi-directional Notch signaling during angiogenesis.
23300792 2012 Notch signaling in descending thoracic aortic aneurysm and dissection.
23295735 2013 NOTCH1 mutations identify a genetic subgroup of chronic lymphocytic leukemia patients with high risk of transformation and poor outcome.
23289374 2013 Notch1 is required for hypoxia-induced proliferation, invasion and chemoresistance of T-cell acute lymphoblastic leukemia cells.
23252402 2013 Non-degradative ubiquitination of the Notch1 receptor by the E3 ligase MDM2 activates the Notch signalling pathway.
23243274 2013 Integrated mutational and cytogenetic analysis identifies new prognostic subgroups in chronic lymphocytic leukemia.
23239744 2013 Cross-talk between leukemic and endothelial cells promotes angiogenesis by VEGF activation of the Notch/Dll4 pathway.
23235341 2013 Significance of Notch1-signaling pathway in human pancreatic development and carcinogenesis.
23226395 2012 Hepatitis C virus mediated changes in miRNA-449a modulates inflammatory biomarker YKL40 through components of the NOTCH signaling pathway.
23225326 2013 Notch 1 tumor expression is lacking in highly proliferative pancreatic neuroendocrine tumors.
23179396 2013 Associations between high levels of Notch1 expression and high invasion and poor overall survival in hepatocellular carcinoma.