Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.28
PubTator Score 3.44

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
chronic lymphocytic leukemia 2.385 3.0e-05
Multiple myeloma 1.187 2.3e-03
psoriasis 1.400 3.9e-04
osteosarcoma -1.165 1.1e-03
primary pancreatic ductal adenocarcinoma -1.824 7.2e-04
lung cancer 1.400 4.3e-03
ovarian cancer 2.500 2.3e-07
pancreatic cancer -1.700 6.4e-04

Gene RIF (2)

PMID Text
16135813 Endogenous NOSIP reduces the enzymatic capacity of eNOS, specifically in the G(2) phase of the cell cycle by targeting eNOS to the actin cytoskeleton.
11149895 endothelial nitric oxide synthase (eNOS) interacting protein (NOSIP), modulator of eNOS activity by alteration of eNOS subcellular localisation; high expression levels in endothelial cells and vascularized tissue.

AA Sequence

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAI      1 - 70
LEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPD     71 - 140
DVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVD    141 - 210
RVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGG    211 - 280
TGFAGSGVKLQAEKSRPVMQA                                                     281 - 301
//

Text Mined References (22)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20082095 2010 Cellular signaling and NO production.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16135813 2005 Cell cycle-regulated inactivation of endothelial NO synthase through NOSIP-dependent targeting to the cytoskeleton.
15635413 2005 Nucleolar proteome dynamics.
15548660 2004 Nitric oxide synthase (NOS)-interacting protein interacts with neuronal NOS and regulates its distribution and activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11149895 2001 NOSIP, a novel modulator of endothelial nitric oxide synthase activity.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.