Property Summary

Ligand Count 89
NCBI Gene PubMed Count 1,851
PubMed Score 9525.31
PubTator Score 3944.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hypertension 396 6.859 3.4
Atherosclerosis 291 6.181 3.1
Coronary artery disease 268 5.973 3.0
Hyperglycemia 137 4.717 2.4
Hyperinsulinism 133 3.194 1.6
Abruptio Placentae 3 0.0 0.0
Acute kidney injury 70 0.0 0.0
Adenocarcinoma 122 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Arteriosclerosis 11 0.0 0.0
Atrial Fibrillation 124 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Cardiomegaly 116 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Cerebral Infarction 10 0.0 0.0
Cleft Lip 141 0.0 0.0
Cleft Palate 271 0.0 0.0
Coronary Vasospasm 3 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic Angiopathies 16 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Enterocolitis, Necrotizing 17 0.0 0.0
Erectile dysfunction 32 0.0 0.0
Esophageal Neoplasms 69 0.0 0.0
Essential Hypertension 94 0.0 0.0
Fetal Growth Retardation 189 0.0 0.0
Heart failure 162 0.0 0.0
Hernia, Diaphragmatic 40 0.0 0.0
Hyperlipidemias 17 0.0 0.0
Hypertension, Portal 22 0.0 0.0
Hypertension, Pregnancy-Induced 2 0.0 0.0
Hypertension, Pulmonary 37 0.0 0.0
Hypertension, Renovascular 10 0.0 0.0
Hypoxia 33 0.0 0.0
Infertility, Male 46 0.0 0.0
Insulin Resistance 72 0.0 0.0
Intestinal perforation 7 0.0 0.0
Ischemia 28 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Metabolic Syndrome 20 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Myocardial Reperfusion Injury 37 0.0 0.0
Neoplasms 63 0.0 0.0
Pre-Eclampsia 68 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Pulmonary edema 17 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Sepsis 24 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Tachycardia, Ventricular 22 0.0 0.0
Uremia 19 0.0 0.0
Ureteral obstruction 33 0.0 0.0
Ventricular Premature Complexes 1 0.0 0.0
Vestibular Diseases 7 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.600 3.6e-06
atypical teratoid/rhabdoid tumor -1.100 5.9e-05
group 4 medulloblastoma -1.200 1.0e-05
interstitial cystitis 1.500 5.3e-04

PDB (22)

Gene RIF (2171)

AA Sequence

MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPR      1 - 70
VKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKR     71 - 140
SGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTY    141 - 210
ICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWT    211 - 280
PGNGRFDVLPLLLQAPDEPPELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPA    281 - 350
APFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH    351 - 420
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGSAAKGTGI    421 - 490
TRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVS    491 - 560
LEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSISCSDPLVSSWRRKR    561 - 630
KESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQ    631 - 700
AAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQ    701 - 770
SSKSTRATILVRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP    771 - 840
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRYEEWKWFRCPT    841 - 910
LLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVLAYRTQDGLGPLHYGVCSTWL    911 - 980
SQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPTPMTLVFGCRC    981 - 1050
SQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMA   1051 - 1120
TNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVP   1121 - 1190
WAFDPPGSDTNSP                                                            1191 - 1203
//

Text Mined References (1858)

PMID Year Title