Property Summary

NCBI Gene PubMed Count 96
PubMed Score 142.62
PubTator Score 140.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 3.2e-09
atypical teratoid / rhabdoid tumor -1.500 2.1e-06
ependymoma -1.300 5.6e-10
glioblastoma -1.200 3.2e-09
lung carcinoma 1.800 1.7e-38
medulloblastoma -1.100 8.0e-05
pediatric high grade glioma -1.100 3.4e-07
primitive neuroectodermal tumor -1.100 8.4e-03

Gene RIF (100)

AA Sequence

MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKK      1 - 70
KVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNI     71 - 140
FRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERAST    141 - 210
ATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPG    211 - 280
LGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHIS    281 - 350
LLVKQVQELELKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG    351 - 420
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNV    421 - 490
LQRQELGDGLDDEIAV                                                          491 - 506
//

Text Mined References (102)

PMID Year Title