Property Summary

Ligand Count 504
NCBI Gene PubMed Count 329
PubMed Score 1885.84
PubTator Score 1313.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 0.8
Large intestine cancer 126 0.0 0.7
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 0.8
Disease Target Count
Achalasia, Familial Esophageal 3

Expression

  Differential Expression (17)

Disease log2 FC p
Duchenne muscular dystrophy -1.106 6.5e-07
acute quadriplegic myopathy -1.064 5.6e-04
astrocytic glioma -1.600 1.2e-03
atypical teratoid/rhabdoid tumor -1.100 2.3e-04
ependymoma -1.700 9.5e-04
glioblastoma -1.200 1.9e-03
group 3 medulloblastoma -1.700 5.4e-03
lung carcinoma 1.400 7.8e-04
medulloblastoma, large-cell -1.100 7.4e-04
oligodendroglioma -1.600 7.4e-04
osteosarcoma 1.471 4.8e-02
ovarian cancer 1.100 1.6e-09
pediatric high grade glioma -1.200 7.0e-05
periodontitis -1.200 2.5e-18
pituitary cancer -1.700 5.3e-03
primitive neuroectodermal tumor -1.300 1.3e-03
psoriasis 1.300 2.3e-05

PDB (30)

Gene RIF (311)

AA Sequence

MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGR      1 - 70
PLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPP     71 - 140
AGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAPRPPGQDPAKKATRVSLQGRGENNELLKEIE    141 - 210
PVLSLLTSGSRGVKGGAPAKAEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYS    211 - 280
EKEQPPTSGKQSPTKNGSPSKCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRP    281 - 350
EDVRTKGQLFPLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC    351 - 420
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGY    421 - 490
KQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFEWFK    491 - 560
DLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRKTSSLW    561 - 630
KDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEM    631 - 700
LNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGK    701 - 770
SQAYAKTLCEIFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ    771 - 840
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEE    841 - 910
LGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTFVA    911 - 980
EAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGSQELQYQPGDHLGVFPGNHEDLVN    981 - 1050
ALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASL   1051 - 1120
ATSEKEKQRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYP   1121 - 1190
DEVHLTVAIVSYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP   1191 - 1260
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDKPKKYVQD   1261 - 1330
ILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIF   1331 - 1400
GVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS                                       1401 - 1434
//

Text Mined References (330)

PMID Year Title