Property Summary

NCBI Gene PubMed Count 309
PubMed Score 1820.85
PubTator Score 1313.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.600 1.2e-03
ependymoma -1.700 9.5e-04
oligodendroglioma -1.600 7.4e-04
osteosarcoma 1.471 4.8e-02
glioblastoma -1.200 1.9e-03
group 3 medulloblastoma -2.800 3.8e-06
periodontitis -1.200 2.5e-18
medulloblastoma, large-cell -1.100 7.4e-04
primitive neuroectodermal tumor -1.800 1.6e-03
Duchenne muscular dystrophy -1.106 6.5e-07
acute quadriplegic myopathy -1.064 5.6e-04
pediatric high grade glioma -1.200 7.0e-05
atypical teratoid/rhabdoid tumor -1.100 2.3e-04
psoriasis 1.300 2.3e-05
lung carcinoma 1.400 7.8e-04
ovarian cancer -1.800 1.1e-07
pituitary cancer -1.700 5.3e-03

Gene RIF (294)

PMID Text
26923072 DLC1 binding to nNOS-calmodulin complex does not affect the electron transport from the reductase to the oxygenase domain.
26791826 We conclude that DNM2 is a novel negative regulator of NO production in mouse collecting ducts.
26458913 CoCl2 increased nNOS expression and NO production in human neuroblastoma SK-N-SH cells by increasing HIF-1a expression and binding to a a hypoxia response element in the nNos promoter.
26378238 analysis of the interaction between nNOS and dystrophin repeats 16 and 17
25902315 This study first-time showed highest Red Blood Cell (RBC)-Nitric Oxide Synthase activation and nitric oxide production in old RBC.
25871004 polymorphisms in the gene may be useful in identifying women at risk for osteoporosis.
25855559 Single nucleotide polymorphisms in nNOS, renalase, MTHFR, CELSR1 and XYLB genes were found significantly associated with ischemic stroke in Chinese patients.
25724429 Tetrahydrobiopterin:dihydrobiopterin ratio is lower in tumor tissues and, as a consequence, NOS activity generates more peroxynitrite and superoxide anion than nitric oxide, resulting in important tumor growth-promoting and antiapoptotic signaling properties.
25613138 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25490993 Results suggested a link between NOS1 gene polymorphism at rs3782206 and cognitive functions and their neural underpinnings at the right inferior frontal gyrus
25460324 Studied and determined the localisation of neuronal NOS (nNOS) in human airway epithelium.
25366612 This review will focus on the role of Nitric Oxide Synthases (NOSes) the role they play in the pathogenesis of subarachnoid hemorrhage.
25300364 Study found no significant differences either in the frequencies of the NOS1 rs7977109 and rs693534 genotypes or in the frequencies of the allelic variants of these SNPs in restless legs syndrome patients when compared with healthy controls
25286850 the first structure of human neuronal nitric oxide syntahse
25170949 2-methoxyestradiol specifically affects neuronal nitric oxide synthase and augments 3-nitrotyrosine level leading to osteosarcoma and immortalized hippocampal cell death.
25126568 rADI not only reduced NO production but also caused cellular toxicity in nNOS-activated SH-SY5Y cells, suggesting a dual role for rADI in NOS-mediated neurotoxicity.
24917196 Results suggest that NOS1 SNPs interact with exposure to economic and psychosocial stressors to alter individual's susceptibility to depression
24897285 The NOS1 rs41279104 CT genotype was associated with good responders in postoperative ED patients.
24801117 we discuss the idea that post-translational modifications of Ca2 + regulatory proteins via aberrant neuronal nitric oxide synthase (NOS1)-mediated nitroso-redox balance contribute to contractility defects in Heart failure
24713495 Studied which NOS gene variants are most strongly associated with coronary heart disease (CHD) and hypertension and confirmed NOS1 as the most important NOS risk gene for CHD.
24710408 Genetic or pharmacologic inhibition of NOS1 reduced the growth of CXCL14-expressing fibroblasts.
24691438 Evaluation of NOS1 levels in melanomas and IFN responsiveness of purified PBMCs from patients indicated a negative correlation between NOS1 expression in melanomas and the responsiveness of PBMCs to IFN-alpha.
24668187 T allele of rs2293050 and A allele of rs2139733 in nNOS gene may contribute to increased susceptibility of LAA-caused ischemic stroke in Han Chinese
24666322 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24622112 DNA methylation of NOS1 plays role in atherogenesis through regulation of NO production.
24573959 Population genetic variability in Sardinia (Italy) shows a positive and highly significant correlation between mortality determined by malaria infection and alleles (TGGA)7 of NOS2, (AAAAG)2 and (ATTT)10 of adNOS1, and (AAACA)11 of adNOS3 genes.
24251120 Results identified NOS1 as a novel nitric oxide target in human skeletal muscle controlled by activity driven auto-nitrosylation mechanisms.
24235139 alpha-Syntrophin, which resides in nuclei of myocytes, functions as the upstream mediator of nuclear nNOS translocation and nNOS-dependent mitochondrial biogenesis.
24220657 The resukts of this study demonistrated that the risk allele significantly decreases expression of NOS1 in the prefrontal cortex in patient with schizophrenia.
24192154 Polymorphism rs41279104 in the NOS1 gene was not associated with lung function or chronic obstructive pulmonary disease status.
24114042 NOS1 polymorphism is associated with susceptibility to functional dyspepsia (FD) and influences satiation in FD patients
24082858 The results showed that rs7308402 gene polymorphism of nNOS is related to ischemic stroke in Han Chinese of North China.
24063785 The A and B helices of dystrophin are not crucial by themselves for the interaction, but that the A-B loop is involved in the dystrophin-nNOS interaction.
23953641 Increased cellular expression of nNOS was accompanied by elevated NO generation in brains of heroin addicts and may have contributed to some of the known toxic effects of heroin.
23826716 This study provides evidence for the association between selected NOS2 and NOS3 markers and Multiple sclerosis(MS) susceptibility; NOS1 showed no significant association with MS.
23770231 up-regulation of the cardiac expression of n NOS isoform in the failing heart, which is not mirrored by peripheral blood mononuclear cells is related to an improved health status
23727770 This novel bioelectronic system showed potential for further investigation of NOS and biosensor applications.
23572278 Genetic variability of NOS genes has an effect on common age related phenotypes and longevity in humans.
23567464 the rate constants for the charge transfer between NADP(+) and FADH2 have been determined for NOS.
23541953 Cav3 is an important negative regulator for cardiac late sodium cutrrent via nNOS dependent direct S-nitrosylation of SCN5A.
23406356 we demonstrated that nNOS is a relevant regulator in controlling migration of human-induced pluripotent stem cell-derived neural stem/progenitor cells toward cancer cells
23289611 Three charge-pairing residues on the FMN domain govern electron flux through nNOSred by stabilizing its closed (FMN-shielded) conformational state and by retarding the rate of conformational switching between its open and closed conformations.
23159936 Data suggest that CaM (calmodulin) binding to nNOS (neuronal nitric oxide synthase) produces major shift in conformational equilibrium; CaM activation of nNOS changes distribution of conformations and environment of FMN (flavin mononucleotide).
23062293 The NOS1 ex1f-VNTR variant influences personality and emotional regulation dependent on gender and environment.
22989585 A report on the reduction of NOS1 expression in the anterior cingulate cortex in depressive patients.
22937753 This study showed that there is no marked association between the C276T polymorphism of the nNOS gene and migraine.
22885173 We have shown that beta-methyl-amino-L-alanine induces the expression of neuronal nitric oxide synthase (nNOS) and caspase-3 indicating that it can stimulate apoptosis in human neurons.
22875507 One NOS1 SNP (rs1520811) was found to be associated with schizophrenia.
22797309 Skeletal muscle nNOS protein is higher in obese subjects compared to the nonobese group.
22613021 nNOS may be involved in modulating axotomy responses in dorsal root ganglion (DRG)-spinal network.
22589245 cytosolic mislocalization of nNOSmu was associated with the more severe phenotypes.
22579290 Study identifies a species-dependent posttranscriptional regulation of human NOS1 by FMRP in specific neocortical circuits during column development and synaptogenesis, and showed it to be altered in Fragile X syndrome.
22560594 The current data on nNOS suggest a dysregulation of the nitrergic system in bipolar disorder.
22486744 A phosphomimetic Y99E calmodulin significantly reduces the maximal synthase activity of eNOS while having little effect on nNOS or iNOS activity.
22457368 potential anti-inflammatory role of endothelial nNOS that can attenuate unopposed, proinflammatory cytokine actions.
22448456 findings suggest that AAT polymorphisms in intron 20 of NOS1 may confer vulnerability to mite-induced allergic rhinitis in Chinese patients
22374200 all isoforms of NOS are expressed in leukocytes in middle turbinates and nasal polyps and their expression varies among leukocyte types
22227051 While the mechanisms by which NOS1 may influence brain structure and/or function have not yet been well delineated, these data provide further evidence for a role of NOS1 in risk for schizophrenia via an impact upon cognitive function
22095614 nNOS positive cells in the developing corpus striatum appear early (21-23 weeks) in gestation, while 5-HT(2A) receptor- positive cells were not observed until 31/32 weeks gestation.
22008325 19 polymorphisms in the coding region of NOS1 were found in infants with infantile hypertrophic pyloric stenosis but showed no significant association with it.
22003386 Survival of dystrophin/utrophin double-knockout (dko) mice was increased by muscle-specific expression of a neuronal nitric oxide synthase (nNOS) transgene
21922604 Our data confirm an influence of NOS1 polymorphisms on impulsivity
21847584 Data suggest that increased nNOS production and dimerization, together with relative decrease in catalytic activity and re-localization to mitochondria, are involved in beta cell hyperactivity in islets isolated from obese individuals.
21724667 NOS1 genotype influences impulsivity and its relation with ADHD is mediated through effects on this behavioral trait. Increased ventral striatal activity related to NOS1 may be compensatory for effects in other brain regions.
21722677 Constitutive presence of all the NOS isoforms in PBMCs and a the distinct pattern of NOS distribution among monocytes and lymphocytes.
21679499 genetic polymorphism is associated with severe chronic rhinosinusitis
21642500 Report increased endothelial and neuronal NOS activity in postural tachycardia syndrome with splanchnic hyperemia.
21620982 data showed a significant differences in brain activation between subjects carrying short and the long alleles of the NOS1 gene.
21613201 neonatal ADRB2 p.Arg16 homozygosity, but not nitric oxide synthase genotype, confers a protective effect against developing ephedrine-induced fetal acidemia
21612410 Functional variants in NOS1 and NOS2A are not associated with progressive hearing loss in Meniere's disease in a European Caucasian population.
21577011 This study did not support the nos1 is direct modulation of these genes on temperament
21545853 Study has identified that nNOS is posttranslationally modified by SUMO-1.
21520349 NOS1 variant rs6490121 influences visual sensory processing as measured by the P1 response, either as part of the gene's pleiotropic effects, or because of a primary influence on sensory processing already seen in higher cognitive processes.
21505843 In conclusion, the expression of nNOS at mRNA and protein levels was statistically linked to capillarity after exercise suggesting that nNOS is involved in the angiogenic response to training in human skeletal muscle.
21467233 Single Nucleotide Polymorphism in NOS1 gene may be associated with pancreatic cancer.
21413022 Intracellular nitric oxide levels regulate synchronization of [Ca(2+) ](i) oscillations in undifferentiated adipose tissue-derived mesenchymal stem cells by controlling gap-junctional coupling.
21403107 nNOS mislocalization is observed in a broad range of nondystrophic neuromuscular conditions associated with impaired mobility status and catabolic stress.
21281558 fNIRS data extend previous studies suggesting disturbed prefrontal functioning in schizophrenia and suggest that genetic variation of NOS1 has a role in cognitive dysfunction.
21204701 nNOS was not expressed in blood and CSF of meningitis patients and the control group.
21098972 either long alleles of NOS1 ex1f-VNTR are protective against disease or conversely, short alleles predispose to earlier onset of disease.
21056687 Neuronal nitric oxide synthase interacts with Sp1 through the PDZ domain inhibiting Sp1-mediated copper-zinc superoxide dismutase expression.
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21039601 Observational study of gene-disease association. (HuGE Navigator)
20921115 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20888049 SNPs associated with recurrent depressive disorder
20888049 Observational study of gene-disease association. (HuGE Navigator)
20818978 There were significant negative correlations of latitude with frequencies of alleles S & genotypes S/S & S/L. The north-south gradient of S alleles supports our hypothesis about selective action of malaria infection on the NOS1 gene.
20818978 Observational study of genotype prevalence. (HuGE Navigator)
20729196 the C331A mutant of neuronal nitric-oxide synthase is labilized for Hsp70/CHIP (C terminus of HSC70-interacting protein)-dependent ubiquitination
20705916 Nitic oxide synthase(NOS)activity is required for circulating angiogenic cells(CACs) chemotaxis. In coronary artery disease(CAD)impairment of NOS expression may contribute to dysfunction of CACs and limit their regenerative capacity.
20645313 Expression analysis of pan-NOS1 and 2 of its isoforms, "NOS1_1d" and "NOS1_1f", revealed a trend for pan-NOS1 over-expression in schizophrenia patients, and significant over-expression of NOS1_1d and NOS1_1f
20645313 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20609134 gene polymorphism is associated with asthma in Taiwanese children
20609134 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20605417 The findings of this study provided further evidences that NOS1 is associated with a biological susceptibility gene to schizophrenia.
20605417 Observational study of gene-disease association. (HuGE Navigator)
20589495 This study provides further evidence that short alleles of NOS1 ex1f-VNTR go along with impulsive behavior.
20589495 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20581851 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20547234 The data showed that the expression of neuronal NOS (nNOS) was increased.
20537599 Nerve fibers containing neuronal nitric oxide synthase richly innervate human cerebral arteries.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20470850 genetic variation of NOS1 may be implicated in the pathophysiology of suicide in Japanese population, especially in males.
20470850 Observational study of gene-disease association. (HuGE Navigator)
20447567 Review: nNOS plays an important role in the local regulation of vessel tone , independent of the effects of nNOS-derived NO in the central nervous system.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20435320 we demonstrated that nNOS dislocated from the sarcolemma to the cytoplasm may be the upstream disease-modifying event of muscle atrophy in human ALS and transgenic mice
20421643 our results suggest that, in the human system, nNOS-, but not iNOS-derived NO, plays an important regulatory role for the maturation of dendritic cells
20406964 Observational study of gene-disease association. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20385275 No association was found between NOS1 polymorphism and infantile hypertrophic pyloric stenosis in a Chinese population
20385275 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20232214 The present study was undertaken to assess the intracellular distribution of NOS isoforms by transmission electron microscopy followed by morphometric analysis in human and rat eosinophils.
20186396 study supports evidence for higher impulsivity in the NOS1 short/short genotype subjects and further suggests that this is present in the subset of subjects who have close to average platelet MAO activity.
20186396 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20060328 Pressurization did not affect the immunostaining of nNOS in human saphenous vein.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20052609 Some support (at a nominal significance level of 0.05/0.01) was found for association between NOS1 and personality traits (especially extraversion)
20043967 Metabotropic glutamate receptor 5 activation inhibits the glutamate-nitric oxide-cGMP pathway by reducing NMDA-induced activation of neuronal nitric oxide synthase
20028935 Observational study of gene-disease association. (HuGE Navigator)
20016223 This study did not detect an association between only one marker (rs41279104) in NOS1 and Japanese mood disorder patients and fluvoxamine response.
20016223 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19997858 The findings give additional evidence that NOS-I is involved in the regulation of impulsive personality traits and support the notion that the NOS1 gene takes part in the regulation of social behavior.
19997858 Observational study of gene-disease association. (HuGE Navigator)
19948738 Lys842 in neuronal nitric-oxide synthase enables the autoinhibitory insert to antagonize calmodulin binding, increase FMN shielding, and suppress interflavin electron transfer
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851341 Data could not confirm any association between the analyzed SNP and infantile hypertrophic pyloric stenosis.
19851341 Observational study of gene-disease association. (HuGE Navigator)
19844207 Observational study of gene-disease association. (HuGE Navigator)
19805695 NOS1 is associated with clinically significant variation in cognition. Whether this is a mechanism by which schizophrenia risk is increased (eg, via an influence on cognitive reserve) is yet to be confirmed.
19726747 These results identify nNOS as a target gene of a novel RA/PI3K/Akt/DAX1-dependent pathway in human neuroblastoma cells
19726320 nNOS, Pax3 and Cx43 proteins are closely related to the growth and development of the spinal cord in human embryos and fetuses.
19711100 Data suggest that neither the co-existence nor the co-absence of choline acetyltransferase and neuronal nitric oxide synthase in human myenteric neurons is indicative for particular neuron types.
19687346 Methylglyoxal-induced LOX-1 expression is mediated via arginase upregulation likely because of uncoupling of NO synthase, which may have implications in preeclampsia.
19657898 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19603529 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19552920 NOS1 ex1f-VNTR might be a molecular connection between at least some forms of parkinson disease,Restless Legs Syndrome, and Attention Deficit Disorder with Hyperactivity.
19513863 Results could not replicate the association between seven SNPs in NOS1 and schizophrenia found in several earlier studies, using larger Japanese schizophrenia and control samples.
19505917 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19457105 Thus, the formation of clusters containing HSP90, mu-calpain, nNOS and NMDA-R represents the limiting step for the operation of the mechanism that links an efficient synthesis of NO to a local increase in Ca(2+) influx.
19433760 local nNOS-derived NO regulates basal blood flow in the human coronary vascular bed, whereas substance P-stimulated vasodilatation is eNOS mediated.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19423521 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19415232 Common NOS1 and rare NOX1 variants revealed a suggestive association with diabetic nephropathy
19415232 Observational study of gene-disease association. (HuGE Navigator)
19372141 Observational study of gene-disease association. (HuGE Navigator)
19371282 The nNOS gene polymorphism may be associated with MCNS in children, but further studies in a larger population with different glomerular diseases are needed to confirm the results.
19371282 Observational study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
19326438 These data suggest that if smaller polymorphism size contributes to the higher NOS1 levels in PD patients.
19326438 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19124687 A novel functional promoter polymorphism in NOS1 was associated with traits related to impulsivity, including hyperactive and aggressive behaviors.
19124687 Observational study of gene-disease association. (HuGE Navigator)
19103196 Results highlighted the high frequencies of allele with 16 and 17 repeats in the thalassemic sample.
19103196 Observational study of gene-disease association. (HuGE Navigator)
19087148 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18971208 A diminished NO generation by injured endothelium and loss of macula densa neuronal NOS could impair the vasodilatory ability of the renal vasculature and contribute to the reduction in the glomerular filtration rate in postischemic acute kidney injury.
18953332 Sarcolemmal nNOS staining was decreased in patient biopsies from a large number of distinct myopathies
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18675932 nNOS was more frequently expressed in normal than in osteoarthritic chondrocytes, whereas the opposite was found for iNOS; IL-1 induced the degradation of both enzymes, but iNOS disappeared more rapidly
18671896 Data show that nNOS expression in glial tumors is significantly positive correlated with malignancy and tumor proliferation.
18614941 AMPK alpha2 activity, AMPK alpha2 Thr172 phosphorylation, and ACC-beta Ser222 phosphorylation were increased immediately after exercise. These increases had all returned to basal levels at 3 and 24 h after exercise.
18606955 Observational study of gene-disease association. (HuGE Navigator)
18591664 These results establish an SNTA1-based nNOS complex attached to SCN5A as a key regulator of sodium current and suggest that SNTA1 be considered a rare long QT syndrome-susceptibility gene.
18563708 Observational study of gene-disease association. (HuGE Navigator)
18544180 Our results strongly support a previous hypothesis that NOS1 contributes to the genetic risk of schizophrenia
18544180 Observational study of gene-disease association. (HuGE Navigator)
18541744 Cardiomyocyte NOS1 may be a useful target against cardiac deterioration during chronic pressure-overload-induced heart failure through modulation of calcium cycling.
18465682 Expression of this isoform is reduced in skeletal muscle in type 1 diabetes.
18391107 Basal forearm blood flow in humans is regulated by nNOS-derived nitric oxide. Vascular nNOS has a distinct local role in the physiological regulation of human microvascular tone in vivo.
18257968 functional polymorphism in NOS1 was associated with lower loudness dependence of auditory evoked potentials
18257968 Observational study of gene-disease association. (HuGE Navigator)
18086269 Observational study of gene-disease association. (HuGE Navigator)
18058820 this study provides evidence for an association of variants in the NOS1 gene and RLS, and suggests the involvement of the NO/arginine pathway in the pathogenesis of RLS.
18058820 Observational study of gene-disease association. (HuGE Navigator)
18048451 nNOS isoform has distinct physiological roles in cardiovascular control mechanisms in humans, in vivo. nNOS isoform affects NO increases and vasodilatation during centrally mediated, reflex responses to whole-body heat stress.
18042235 The C276T SNP acts as risk factor for sporadic FTLD, possibly influencing NOS1 transcription. Studies in larger populations are needed to confirm its role in PSP and CBD.
18024942 NOS1 was elevated during tourniquet-induced ischemia/reperfusion.
17970747 Proteolytic degradation of NOS1 by calpain is modulated by the expression levels of HSP90.
17924542 Total NOS1 protein content was reduced by 41% in patients with critical illness myopathy compared to controls
17703412 Observational study of gene-disease association. (HuGE Navigator)
17690329 Observational study of gene-disease association. (HuGE Navigator)
17660395 Suggest that NO generation via nNOS, but not NO generation via eNOS, is reduced in low-flow postural tachycardia syndrome.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17579350 a possible involvement of NOS-I(nitric oxide synthase 1) gene variants in suicidal behavior and related intermediate phenotypes.
17579350 Observational study of gene-disease association. (HuGE Navigator)
17536218 Observational study of gene-disease association. (HuGE Navigator)
17536218 NOS1 exon 29 CA-repeat may be a risk factor for asthma susceptibility and mite specific IgE response in a Colombian population.
17492662 eNOS and nNOS were not detectable by Western blotting in both peripheral and cord-blood eEPCs upon 3 weeks, and their mRNA levels were lower than 2% relative to those present in HUVECs
17466601 inflammation is associated with a differential expression of VIP and nNOS neuronal subpopulations within the two major enteric plexi, likely due to phenotypic switch in Crohn disease
17459909 nNOS mu protein expression is greater in endurance-trained individuals when compared with sedentary individuals
17448763 Observational study of gene-disease association. (HuGE Navigator)
17418914 Therefore, short alleles of the NOS1 exon 1f-VNTR are likely to be susceptibility factors for AD, and interact with the epsilon 4 allele to markedly increase the AD risk.
17418914 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17365914 For C276T polymorphism distribution of CC, TC, TT and genotypes was 31%, 29%, and 40% in primary nocturnal enuresis compared with 10%, 43%, and 47% in the controls
17365914 Observational study of gene-disease association. (HuGE Navigator)
17360663 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
17359361 reduced activity of respiratory chain complexes with mitochondrial encoded subunits and a lower nNOS amount in amyotrophic lateral sclerosis muscles
17351927 Observational study of gene-disease association. (HuGE Navigator)
17351066 We conclude, therefore, that estrogen opens BK(Ca) channels in HCASMC by stimulating nNOS via a transduction sequence involving PI3-kinase and Akt.
17328085 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17174475 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17161551 CD95 alters NOS1 expression to contribute to diabetic gastroparesis.
17161399 describe a novel interaction between the PDZ domain of nNOS and Vac14
16950998 current findings provide evidence for expression of all 3 of the NOS isoforms at all of the airway levels studied in the developing lung and in all of the levels studied of the developing vascular tree from 22 weeks to term
16848803 Observational study of gene-disease association. (HuGE Navigator)
16848803 NOS gene polymorphisms are not involved in the susceptibility to and nature of the clinical course of sporadic achalasia.
16780147 nNOS and iNOS might be involved in the pathogenesis of allergic rhinitis.
16690617 nNOS is a new p60(src) kinase substrate essential for SST5-mediated anti-proliferative action
16569214 intracellular generation of NO* by nNOS leads to S-nitrosylation of H-Ras, which interferes with Raf-1 activation and propagation of signalling through ERK1/2
16413742 The expression of the different exon 1-related splice variants of NOS1 mRNA is controlled directly (at least in part) by the associated 5'flanking sequences.
16389274 Observational study of gene-disease association. (HuGE Navigator)
16389274 Regulatory polymorphisms of NOS1 contribute to the genetic risk for shizophrenia, and modulate prefrontal brain functioning.
16380905 Observational study of gene-disease association. (HuGE Navigator)
16238787 Observational study of gene-disease association. (HuGE Navigator)
16229016 Nocodazole treatment inhibited TRAIL-increased NOS activity, indicating that, on cultured HUVEC, TRAIL ability to affect NO production by regulating eNOS sub-cellular distribution is mediated by cytoskeleton and Golgi complex modifications.
16191396 Observational study of gene-disease association. (HuGE Navigator)
16191396 The 5' repeat variant of the nNOS gene is the more functional variant expressing gene information that could affect NO synthesis and result in diseased states. However, no association with migraine was seen in the case-control cohort.
15856945 Observational study of gene-disease association. (HuGE Navigator)
15765269 The T/T genotype of the neuronal nitric oxide synthase C276T SNP seems to be associated wtith Alzheimer's disease in Italy population, particularly with early onset.
15699372 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15466472 CHIP is an E3 ligase for nNOS whose action is facilitated by (and possibly requires) its interaction with nNOS-bound hsp70
15287858 NOS-1 mRNA and protein levels hint that not only NOS-3, but also NOS-1 may be involved in the regulation of systemic hyperdynamic circulation and portal hypertension.
15251453 neuronal nitric-oxide synthase activity through serine 741 phosphorylation is inhibited by Calcium/calmodulin-dependent protein kinase I
15242984 Constitutive NOS activities are responsible for E2-induced NO production in neuroblastoma cells. Differential activation of NOS isoforms in these cells occurs in response to different treatments.
15194886 increased activity of nNOS may be involved in the neuroprotection conferred by 17beta-estradiol.
15191553 nNOS expression is regulated in the process of cutaneous wound repair.
15180967 In trained vastus lateralis, NOS 1 protein and immunostaining at myofibers II were significantly increased at the end of head-down-tilt bed rest.
15167446 Observational study of gene-disease association. (HuGE Navigator)
15161750 Intracellular factors able to induce abnormalities in the nNOS monomer/dimer equilibrium could lead to pancreatic beta-cell dysfunction.
15119548 Intron4 polymorphism of the nitric oxide synthase gene is associated with the development of lupus nephritis.
15094474 Neuronal NOS expression in the prefrontal cortex was significantly higher in individuals with schizophrenia.
15088155 Observational study of gene-disease association. (HuGE Navigator)
15080837 Observational study of gene-disease association. (HuGE Navigator)
15080837 NOS1 gene may participate in pathogenesis of high total serum IgE levels in allergic diseases. NOS1 may be candidate gene for IgE-mediated allergy.
15075442 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15075442 The nNOS gene polymorphism may not confer increased susceptibility to Tardive Dyskinesia, although more investigations on other populations are warranted.
15044250 human mast cell lines produce NO in both cytoplasmic and nuclear compartments, and endogenously produced NO can regulate leukotriene production.
15033959 nitric noxide release by nitric oxide synthase 1 (neuronal) would significantly affect available smooth muscle nitric oxide
14980078 IFN-gamma regulates NOS-1 expression through posttranscriptional and posttranslational mechanisms.
14760158 Observational study of gene-disease association. (HuGE Navigator)
14759629 Observational study of gene-disease association. (HuGE Navigator)
14752097 MPP(+)-dependent aconitase inactivation, Tf-iron uptake, and oxidant generation result in the depletion of intracellular tetrahydrobiopterin, leading to the uncoupling of nNOS activity
14711010 Cu,Zn superoxide dismutase and nitric oxide synthase in neurodegenerative processes (review)
14623375 Association analysis for the CA repeat polymorphism of the neuronal nitric oxide synthase (NOS1) gene and schizophrenia.
14615895 The increased NO production with increased expression of iNOS and ncNOS may contribute to the pathological and physiological features of UVB-induced erythema and skin inflammation.
14602725 nNOS can differentially regulate the ERK signal transduction pathway in a manner dependent on the presence of l-arginine and the production of NO*.
12947326 Nitric oxide liberated from enteric neurons participates in the chloride secretory response to stroking in human jejunum in vitro.
12911502 Observational study of gene-disease association. (HuGE Navigator)
12911502 Variations in the NOS1 gene may contribute to atopy without this relationship being reflected by FENO.
12908999 There is no obvious association between ecNOS polymorphism and preeclampsia.
12816735 Results describe the expression of nitric oxide synthases 1, 2, and 3 in patients with chronic obstructive pulmonary disease, suggesting their involvement in muscle dysfunction in this disease.
12802542 nNOS staining was found in nerve fibers branching within seminal vesicle tissue
12787407 NOS1 is strongly expressed in most tubules of the human nephron. Epithelial cells may be major source of nitric oxide in human kidney under physiologic conditions.
12782337 Observational study of gene-disease association. (HuGE Navigator)
12777376 rate of intramolecular electron transfer between the two flavins in the iNOS flavin domain was faster than that of the nNOS flavin domain.
12759556 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12686399 Nitric oxide participates in the phosphorylation of eIF2alpha since nNOS processes are closely related to eIF2alpha(P) positive cells in temporal lobe epilepsy with hippocampal sclerosis
12646269 calmodulin activates electron transfer in the flavin domain of human neuronal nitric oxide synthase
12572877 Observational study of gene-disease association. (HuGE Navigator)
12531780 Observational study of gene-disease association. (HuGE Navigator)
12490535 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12485841 expression in neurons of the Nuc. suprachiasmaticus (SCN) of depressed patients and matched controls
12445599 nitric oxide synthases(inducible, brain and endothelial) were expressed in human pregnant term uterus and did not change in the myometrium during labor
12421162 Observational study of gene-disease association. (HuGE Navigator)
12421162 Association analysis of five polymorphic microsatellite markers in cluster headache (CH) patients reveals that genetic variations in the NOS1 gene do not contribute greatly to CH susceptibility.
12403769 Data report a 89-nucleotide alternatively spliced exon in human neuronal nitric oxide synthase located in the 5'-untranslated region between exon 1 variants and a common exon 2 that contains the translational initiation codon.
12237228 assembly and activation of the heme-deficient neuronal enzyme with various porphyrins
12210288 Observational study of gene-disease association. (HuGE Navigator)
12140778 Observational study of gene-disease association. (HuGE Navigator)
12140778 allelic association of the gene with schizophrenia
12081486 ligand and protein vibrations at the substrate binding site. A study by FTIR.
11960979 quantitative expression of nNOS first exon variants in different human tissues and the characterization of the basal nNOS exon 1c promoter
11890749 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11786430 An alternative promoter of the human neuronal nitric oxide synthase gene is expressed specifically in Leydig cells.
11668616 fine mapping and single nucleotide polymorphism association results of candidate genes for asthma and related phenotypes
11525805 Observational study of gene-disease association. (HuGE Navigator)
11112111 Observational study of gene-disease association. (HuGE Navigator)
10443886 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10203575 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10068656 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9870939 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8943206 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8581564 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
7561697 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
7521167 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells

AA Sequence

MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGR      1 - 70
PLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPP     71 - 140
AGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAPRPPGQDPAKKATRVSLQGRGENNELLKEIE    141 - 210
PVLSLLTSGSRGVKGGAPAKAEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYS    211 - 280
EKEQPPTSGKQSPTKNGSPSKCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRP    281 - 350
EDVRTKGQLFPLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC    351 - 420
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGY    421 - 490
KQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFEWFK    491 - 560
DLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRKTSSLW    561 - 630
KDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEM    631 - 700
LNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGK    701 - 770
SQAYAKTLCEIFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ    771 - 840
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEE    841 - 910
LGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTFVA    911 - 980
EAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGSQELQYQPGDHLGVFPGNHEDLVN    981 - 1050
ALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASL   1051 - 1120
ATSEKEKQRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYP   1121 - 1190
DEVHLTVAIVSYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP   1191 - 1260
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDKPKKYVQD   1261 - 1330
ILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIF   1331 - 1400
GVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS                                       1401 - 1434
//

Text Mined References (310)

PMID Year Title
26923072 2016 The protein inhibitor of nNOS (PIN/DLC1/LC8) binding does not inhibit the NADPH-dependent heme reduction in nNOS, a key step in NO synthesis.
26791826 2016 Dynamin-2 is a novel NOS1? interacting protein and negative regulator in the collecting duct.
26458913 2015 Up-Regulation of Neuronal Nitric Oxide Synthase Expression by Cobalt Chloride Through a HIF-1? Mechanism in Neuroblastoma Cells.
26378238 2015 Structural Basis of Neuronal Nitric-oxide Synthase Interaction with Dystrophin Repeats 16 and 17.
25902315 2015 Increase in Red Blood Cell-Nitric Oxide Synthase Dependent Nitric Oxide Production during Red Blood Cell Aging in Health and Disease: A Study on Age Dependent Changes of Rheologic and Enzymatic Properties in Red Blood Cells.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25855559 2015 Pooled genetic analysis reveals an association of SNPs of only a few genes with risk predisposition to ischemic stroke in a Chinese population.
25724429 2015 The Role of Nitric Oxide Synthase Uncoupling in Tumor Progression.
25490993 2015 Evidence for the contribution of NOS1 gene polymorphism (rs3782206) to prefrontal function in schizophrenia patients and healthy controls.
25460324 2015 Neuronal NOS localises to human airway cilia.
25366612 2015 Nitric oxide synthases: three pieces to the puzzle?
25300364 2015 Neuronal nitric oxide synthase (nNOS, NOS1) rs693534 and rs7977109 variants and risk for restless legs syndrome.
25286850 2014 Structures of human constitutive nitric oxide synthases.
25170949 2014 Neuronal nitric oxide synthase induction in the antitumorigenic and neurotoxic effects of 2-methoxyestradiol.
25126568 2014 Depletion of arginine by recombinant arginine deiminase induces nNOS-activated neurotoxicity in neuroblastoma cells.
24917196 2014 Neuronal nitric oxide synthase (NOS1) polymorphisms interact with financial hardship to affect depression risk.
24897285 2014 nNOS polymorphisms are associated with responsiveness to sildenafil in clinical and postoperative erectile dysfunction.
24801117 2014 Abnormal Ca(2+) cycling in failing ventricular myocytes: role of NOS1-mediated nitroso-redox balance.
24713495 2014 Nitric oxide synthase (NOS) single nucleotide polymorphisms are associated with coronary heart disease and hypertension in the INTERGENE study.
24710408 2014 Cancer-associated fibroblasts expressing CXCL14 rely upon NOS1-derived nitric oxide signaling for their tumor-supporting properties.
24691438 2014 Melanoma NOS1 expression promotes dysfunctional IFN signaling.
24668187 2014 Variants in neuronal nitric oxide synthase gene may contribute to increased ischemic stroke susceptibility in a Han Chinese population.
24622112 2014 NOS1 methylation and carotid artery intima-media thickness in children.
24573959 Analysis of 16 STRs of NOS gene regions and around in six Sardinian populations (Italy).
24251120 2013 Nitrosative stress in human skeletal muscle attenuated by exercise countermeasure after chronic disuse.
24235139 2014 Nuclear recruitment of neuronal nitric-oxide synthase by ?-syntrophin is crucial for the induction of mitochondrial biogenesis.
24220657 2014 The genetic contribution of the NO system at the glutamatergic post-synapse to schizophrenia: further evidence and meta-analysis.
24192154 2013 Nitric oxide synthase polymorphisms, gene expression and lung function in chronic obstructive pulmonary disease.
24114042 2014 Nitric oxide synthase gene polymorphisms in functional dyspepsia.
24082858 2013 Association of nNOS gene polymorphism with ischemic stroke in Han Chinese of North China.
24063785 2013 Molecular clues about the dystrophin-neuronal nitric oxide synthase interaction: a theoretical approach.
23953641 2014 Increased densities of nitric oxide synthase expressing neurons in the temporal cortex and the hypothalamic paraventricular nucleus of polytoxicomanic heroin overdose victims: possible implications for heroin neurotoxicity.
23826716 2013 Association analysis of nitric oxide synthases: NOS1, NOS2A and NOS3 genes, with multiple sclerosis.
23770231 2013 Myocardial and lymphocytic expression of eNOS and nNOS before and after heart transplantation: relationship to clinical status.
23727770 2013 Electrochemically driven biocatalysis of the oxygenase domain of neuronal nitric oxide synthase in indium tin oxide nanoparticles/polyvinyl alcohol nanocomposite.
23572278 2013 Common polymorphisms in nitric oxide synthase (NOS) genes influence quality of aging and longevity in humans.
23567464 2013 Dissecting the kinetics of the NADP(+)-FADH2 charge transfer complex and flavin semiquinones in neuronal nitric oxide synthase.
23541953 2013 Caveolin-3 suppresses late sodium current by inhibiting nNOS-dependent S-nitrosylation of SCN5A.
23406356 2013 Inhibition of neuronal nitric oxide synthase activity promotes migration of human-induced pluripotent stem cell-derived neural stem cells toward cancer cells.
23289611 2013 Charge-pairing interactions control the conformational setpoint and motions of the FMN domain in neuronal nitric oxide synthase.
23159936 2013 Calmodulin activates neuronal nitric oxide synthase by enabling transitions between conformational states.
23062293 2012 Association of a functional variant of the nitric oxide synthase 1 gene with personality, anxiety, and depressiveness.
22989585 2013 Decreased NOS1 expression in the anterior cingulate cortex in depression.
22937753 2013 Lack of association between the C276T polymorphism of the neuronal nitric oxide synthase gene and migraine.
22885173 2012 Excitotoxic potential of the cyanotoxin ?-methyl-amino-L-alanine (BMAA) in primary human neurons.
22875507 2012 [Association study of NOS1 gene polymorphisms and schizophrenia].
22797309 2012 Obesity, insulin resistance, and skeletal muscle nitric oxide synthase.
22613021 2011 The effects of L-NAME on neuronal NOS and SOD1 expression in the DRG-spinal cord network of axotomised Thy 1.2 eGFP mice.
22589245 2012 Variable phenotype of del45-55 Becker patients correlated with nNOS? mislocalization and RYR1 hypernitrosylation.
22579290 2012 Species-dependent posttranscriptional regulation of NOS1 by FMRP in the developing cerebral cortex.
22560594 2012 Immunohistochemical evidence for impaired nitric oxide signaling of the locus coeruleus in bipolar disorder.
22486744 2012 Structure and dynamics of calmodulin (CaM) bound to nitric oxide synthase peptides: effects of a phosphomimetic CaM mutation.
22457368 2012 Neuronal nitric oxide synthase regulates endothelial inflammation.
22448456 2012 AAT polymorphisms in intron 20 of NOS1 confer vulnerability to mite-induced allergic rhinitis in Chinese patients.
22374200 2012 Expression of nitric oxide synthases in leukocytes in nasal polyps.
22227051 2012 The NOS1 variant rs6490121 is associated with variation in prefrontal function and grey matter density in healthy individuals.
22095614 2012 Development of the human corpus striatum and the presence of nNOS and 5-HT2A receptors.
22008325 2011 Genomic variants in the coding region of neuronal nitric oxide synthase (NOS1) in infantile hypertrophic pyloric stenosis.
22003386 2011 Neuronal nitric oxide synthase-rescue of dystrophin/utrophin double knockout mice does not require nNOS localization to the cell membrane.
21922604 2012 NOS1 ex1f-VNTR polymorphism affects prefrontal oxygenation during response inhibition tasks.
21847584 2011 Increased neuronal nitric oxide synthase dimerisation is involved in rat and human pancreatic beta cell hyperactivity in obesity.
21724667 2011 Nitric oxide synthase genotype modulation of impulsivity and ventral striatal activity in adult ADHD patients and healthy comparison subjects.
21722677 2011 Molecular and biochemical characterization of nitric oxide synthase isoforms and their intracellular distribution in human peripheral blood mononuclear cells.
21679499 Polymorphisms in the nitric oxide synthase 1 gene are associated with severe chronic rhinosinusitis.
21642500 2011 Cutaneous constitutive nitric oxide synthase activation in postural tachycardia syndrome with splanchnic hyperemia.
21620982 2011 NOS1 ex1f-VNTR polymorphism influences prefrontal brain oxygenation during a working memory task.
21613201 2011 The effect of maternal and fetal ?2-adrenoceptor and nitric oxide synthase genotype on vasopressor requirement and fetal acid-base status during spinal anesthesia for cesarean delivery.
21612410 2011 Functional variants in NOS1 and NOS2A are not associated with progressive hearing loss in Ménière's disease in a European Caucasian population.
21577011 2011 NCAM1, TACR1 and NOS genes and temperament: a study on suicide attempters and controls.
21545853 2011 Characterization of a novel posttranslational modification in neuronal nitric oxide synthase by small ubiquitin-related modifier-1.
21536106 2012 Regulation of cardiovascular cellular processes by S-nitrosylation.
21520349 2012 A NOS1 variant implicated in cognitive performance influences evoked neural responses during a high density EEG study of early visual perception.
21505843 2012 Exercise-induced angiogenesis correlates with the up-regulated expression of neuronal nitric oxide synthase (nNOS) in human skeletal muscle.
21467233 2011 Inflammation-related gene variants as risk factors for pancreatic cancer.
21413022 2011 NOS inhibition synchronizes calcium oscillations in human adipose tissue-derived mesenchymal stem cells by increasing gap-junctional coupling.
21403107 2011 Loss of sarcolemmal nNOS is common in acquired and inherited neuromuscular disorders.
21281558 2011 A functional promoter polymorphism of neuronal nitric oxide synthase moderates prefrontal functioning in schizophrenia.
21204701 2011 mRNA expressions of inducible nitric oxide synthase, endothelial nitric oxide synthase, and neuronal nitric oxide synthase genes in meningitis patients.
21119059 2010 Characterization of a nitric oxide synthase from the plant kingdom: NO generation from the green alga Ostreococcus tauri is light irradiance and growth phase dependent.
21098972 2011 Association of a functional NOS1 promoter repeat with Alzheimer's disease in the VITA cohort.
21056687 2011 Neuronal nitric oxide synthase interacts with Sp1 through the PDZ domain inhibiting Sp1-mediated copper-zinc superoxide dismutase expression.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
21039601 2011 Genetic variations in nitric oxide synthase and arginase influence exhaled nitric oxide levels in children.
20921115 2010 Biological validation of increased schizophrenia risk with NRG1, ERBB4, and AKT1 epistasis via functional neuroimaging in healthy controls.
20888049 2011 Association between inducible and neuronal nitric oxide synthase polymorphisms and recurrent depressive disorder.
20818978 2010 A gradient of NOS1 overproduction alleles in European and Mediterranean populations.
20729196 2010 C331A mutant of neuronal nitric-oxide synthase is labilized for Hsp70/CHIP (C terminus of HSC70-interacting protein)-dependent ubiquitination.
20705916 2010 Nitric oxide synthase expression and functional response to nitric oxide are both important modulators of circulating angiogenic cell response to angiogenic stimuli.
20645313 2010 Genetic analysis of nitric oxide synthase 1 variants in schizophrenia and bipolar disorder.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20609134 2010 The effects of NOS1 gene on asthma and total IgE levels in Taiwanese children, and the interactions with environmental factors.
20605417 2010 A putative cis-acting polymorphism in the NOS1 gene is associated with schizophrenia and NOS1 immunoreactivity in the postmortem brain.
20589495 2011 A functional NOS1 promoter polymorphism interacts with adverse environment on functional and dysfunctional impulsivity.
20581851 2010 Exploring epistatic relationships of NO biosynthesis pathway genes in susceptibility to CHD.
20547234 2010 Differential roles of nitric oxide synthases in regulation of ultraviolet B light-induced apoptosis.
20537599 2010 Nitroxidergic innervation of human cerebral arteries.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20470850 2010 A common polymorphism in the 3'-UTR of the NOS1 gene was associated with completed suicides in Japanese male population.
20447567 2009 Neuronal nitric oxide synthase and human vascular regulation.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20435320 2010 Neuronal NOS is dislocated during muscle atrophy in amyotrophic lateral sclerosis.
20421643 2010 Neuronal nitric oxide synthase modulates maturation of human dendritic cells.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20385275 2010 Lack of association between nNOS -84G>A polymorphism and risk of infantile hypertrophic pyloric stenosis in a Chinese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20232214 2010 Ultrastructural immunogold localization of nitric oxide synthase isoforms in rat and human eosinophils.
20186396 2010 The effect of a functional NOS1 promoter polymorphism on impulsivity is moderated by platelet MAO activity.
20060328 Immunohistochemical evaluation of three nitric oxide synthase isoforms in human saphenous vein exposed to different degrees of distension pressures.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20052609 2010 Association of existing and new candidate genes for anxiety, depression and personality traits in older people.
20043967 2010 Metabotropic glutamate receptor 5, but not 1, modulates NMDA receptor-mediated activation of neuronal nitric oxide synthase.
20028935 2010 EDNRA variants associate with smooth muscle mRNA levels, cell proliferation rates, and cystic fibrosis pulmonary disease severity.
20016223 2010 Genetic association analysis of functional polymorphisms in neuronal nitric oxide synthase 1 gene (NOS1) and mood disorders and fluvoxamine response in major depressive disorder in the Japanese population.
19997858 2010 Association of a functional variant of neuronal nitric oxide synthase gene with self-reported impulsiveness, venturesomeness and empathy in male offenders.
19948738 2010 Lys842 in neuronal nitric-oxide synthase enables the autoinhibitory insert to antagonize calmodulin binding, increase FMN shielding, and suppress interflavin electron transfer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851341 2009 No association between a promoter NOS1 polymorphism (rs41279104) and Infantile Hypertrophic Pyloric Stenosis.
19844207 2010 Replication of association between schizophrenia and ZNF804A in the Irish Case-Control Study of Schizophrenia sample.
19805695 2009 Influence of NOS1 on verbal intelligence and working memory in both patients with schizophrenia and healthy control subjects.
19726747 2009 Retinoic acid-induced nNOS expression depends on a novel PI3K/Akt/DAX1 pathway in human TGW-nu-I neuroblastoma cells.
19726320 2009 [Expression of nNOS, Pax3 and Cx43 proteins in early developing posterior horn of embryonic and fetal human spinal cord].
19711100 2009 ChAT and NOS in human myenteric neurons: co-existence and co-absence.
19687346 2009 Evidence for increased methylglyoxal in the vasculature of women with preeclampsia: role in upregulation of LOX-1 and arginase.
19657898 2009 Association of five single nucleotide polymorphism loci with asthma in children of Chinese Han nationality.
19603529 2009 Environmental exposures, nitric oxide synthase genes, and exhaled nitric oxide in asthmatic children.
19552920 2010 Is NOS1 a genetic link between RLS and ADHD?
19513863 2009 No association between polymorphisms of neuronal oxide synthase 1 gene (NOS1) and schizophrenia in a Japanese population.
19505917 2009 Lead exposure, polymorphisms in genes related to oxidative stress, and risk of adult brain tumors.
19457105 2009 Calpain-mediated activation of NO synthase in human neuroblastoma SK-N-BE cells.
19433760 2009 Effects of neuronal nitric oxide synthase on human coronary artery diameter and blood flow in vivo.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19423521 2009 Genetic polymorphisms in nitric oxide synthase genes modify the relationship between vegetable and fruit intake and risk of non-Hodgkin lymphoma.
19415232 2009 Microarray analysis of multiple candidate genes and associated plasma proteins for nephropathy secondary to type 2 diabetes among Chinese individuals.
19372141 2009 Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women.
19371282 2009 Nitric oxide synthase gene polymorphisms in children with minimal change nephrotic syndrome.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19326438 2009 The effect of a promoter polymorphism on the transcription of nitric oxide synthase 1 and its relevance to Parkinson's disease.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19124687 2009 Influence of functional variant of neuronal nitric oxide synthase on impulsive behaviors in humans.
19103196 2009 High frequencies of short alleles of NOS1 (CA)n polymorphism in beta(0)39 carriers from Corsica Island (France).
19089323 2009 Biochemistry of soluble guanylate cyclase.
19087148 2009 The NOS3 G894T (Glu298Asp) polymorphism is a risk factor for frontotemporal lobar degeneration.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18971208 2009 Diminished NO generation by injured endothelium and loss of macula densa nNOS may contribute to sustained acute kidney injury after ischemia-reperfusion.
18953332 2008 Sarcolemma-localized nNOS is required to maintain activity after mild exercise.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18720901 2008 Genetic profiling of genes from the oxidative stress pathway among North and South Indians.
18675932 2008 Nitric oxide synthase isoforms and NF-kappaB activity in normal and osteoarthritic human chondrocytes: regulation by inducible nitric oxide.
18671896 2008 Neuronal nitric oxide synthase expression in glial tumors: correlation with malignancy and tumor proliferation.
18614941 2008 Acute exercise does not cause sustained elevations in AMPK signaling or expression.
18606955 2008 Systematic analysis of glutamatergic neurotransmission genes in alcohol dependence and adolescent risky drinking behavior.
18591664 2008 Syntrophin mutation associated with long QT syndrome through activation of the nNOS-SCN5A macromolecular complex.
18563708 2009 Family-based association study between NOS-I and -IIA polymorphisms and autism spectrum disorders in Korean trios.
18544180 2008 Evidence for association between the 5' flank of the NOS1 gene and schizophrenia in the Chinese population.
18541744 2008 Cardiomyocyte overexpression of neuronal nitric oxide synthase delays transition toward heart failure in response to pressure overload by preserving calcium cycling.
18465682 2008 Metabolic profile and nitric oxide synthase expression of skeletal muscle fibers are altered in patients with type 1 diabetes.
18391107 2008 Neuronal nitric oxide synthase regulates basal microvascular tone in humans in vivo.
18257968 2008 Association of functional polymorphisms in NOS1 and NOS3 with loudness dependence of auditory evoked potentials.
18086269 2008 Constitutive nitric oxide synthase gene polymorphisms and house dust mite respiratory allergy in an Algerian patient group.
18058820 2008 Variants in the neuronal nitric oxide synthase (nNOS, NOS1) gene are associated with restless legs syndrome.
18048451 2008 Neuronal nitric oxide synthase control mechanisms in the cutaneous vasculature of humans in vivo.
18042235 2008 Neuronal nitric oxide synthase C276T polymorphism increases the risk for frontotemporal lobar degeneration.
18024942 Alterations in nitric oxide synthase isoforms in acute lower limb ischemia and reperfusion.
17970747 2007 Proteolytic degradation of nitric oxide synthase isoforms by calpain is modulated by the expression levels of HSP90.
17924542 2008 Possible role for nitric oxide dysregulation in critical illness myopathy.
17892502 2008 Influence of salt on subcellular localization of nitric oxide synthase activity and expression in the renal inner medulla.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17690329 2008 IL10 polymorphisms are associated with airflow obstruction in severe alpha1-antitrypsin deficiency.
17660395 2007 Cutaneous neuronal nitric oxide is specifically decreased in postural tachycardia syndrome.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17579350 2008 NOS-I and -III gene variants are differentially associated with facets of suicidal behavior and aggression-related traits.
17568574 2007 Cardiomyocytes as effectors of nitric oxide signalling.
17536218 2007 A NOS1 gene polymorphism associated with asthma and specific immunoglobulin E response to mite allergens in a Colombian population.
17492662 2007 Different expression of NOS isoforms in early endothelial progenitor cells derived from peripheral and cord blood.
17466601 2007 Differential responses of VIPergic and nitrergic neurons in paediatric patients with Crohn's disease.
17459909 2007 Skeletal muscle nNOS mu protein content is increased by exercise training in humans.
17448763 2007 Application of HapMap data to the evaluation of 8 candidate genes for pediatric slow transit constipation.
17418914 2008 Association of a NOS1 promoter repeat with Alzheimer's disease.
17365914 2007 Nitric oxide synthase gene polymorphisms in children with primary nocturnal enuresis: a preliminary study.
17359361 2007 Activities of mitochondrial complexes correlate with nNOS amount in muscle from ALS patients.
17351927 2007 Physician-diagnosed asthma and acute chest syndrome: associations with NOS polymorphisms.
17351066 2007 Nongenomic, endothelium-independent effects of estrogen on human coronary smooth muscle are mediated by type I (neuronal) NOS and PI3-kinase-Akt signaling.
17328085 2007 Polymorphisms of the neuronal and inducible nitric oxide synthase genes and the risk of cutaneous melanoma: a case-control study.
17174475 2007 No association between Parkinson's disease and three polymorphisms in the eNOS, nNOS, and iNOS genes.
17161551 2007 Fas (CD95) alters neuronal nitric oxide synthase expression to contribute in diabetic gastroparesis.
17161399 2006 Binding of Vac14 to neuronal nitric oxide synthase: Characterisation of a new internal PDZ-recognition motif.
17029414 2006 Role of Asp1393 in catalysis, flavin reduction, NADP(H) binding, FAD thermodynamics, and regulation of the nNOS flavoprotein.
17027776 2006 Nitric oxide synthase in retina and optic nerve head of rat with increased intraocular pressure and effect of timolol.
16950998 2006 Pulmonary nitric oxide synthases and nitrotyrosine: findings during lung development and in chronic lung disease of prematurity.
16848803 2006 Association between achalasia and nitric oxide synthase gene polymorphisms.
16780147 2006 [Expression of cell adhesion molecule and nitric oxide synthase in nasal mucosa in allergic rhinitis].
16690617 2006 Regulation of neuronal nitric-oxide synthase activity by somatostatin analogs following SST5 somatostatin receptor activation.
16569214 2006 Neuronal nitric oxide synthase-induced S-nitrosylation of H-Ras inhibits calcium ionophore-mediated extracellular-signal-regulated kinase activity.
16541075 2006 The finished DNA sequence of human chromosome 12.
16413742 2006 Transcription of human neuronal nitric oxide synthase mRNAs derived from different first exons is partly controlled by exon 1-specific promoter sequences.
16389274 2006 A neuronal nitric oxide synthase (NOS-I) haplotype associated with schizophrenia modifies prefrontal cortex function.
16380905 2005 Bipolar I disorder and schizophrenia: a 440-single-nucleotide polymorphism screen of 64 candidate genes among Ashkenazi Jewish case-parent trios.
16276418 2005 Hypoxia induces a functionally significant and translationally efficient neuronal NO synthase mRNA variant.
16238787 2005 Nitric oxide synthase polymorphisms and asthma phenotypes in Chinese children.
16229016 2006 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) regulates endothelial nitric oxide synthase (eNOS) activity and its localization within the human vein endothelial cells (HUVEC) in culture.
16191396 2005 A population genomics overview of the neuronal nitric oxide synthase (nNOS) gene and its relationship to migraine susceptibility.
15856945 [Polymorphic markers of the NO synthase genes and genetic predisposition to diabetic polyneuropathy in patients with type 1 diabetes mellitus].
15765269 2005 Association of neuronal nitric oxide synthase C276T polymorphism with Alzheimer's disease.
15699372 2005 Family-based case-control study of cigarette smoking and Parkinson disease.
15548660 2004 Nitric oxide synthase (NOS)-interacting protein interacts with neuronal NOS and regulates its distribution and activity.
15466472 2004 Ubiquitylation of neuronal nitric-oxide synthase by CHIP, a chaperone-dependent E3 ligase.
15287858 2004 Nitric oxide synthase 1 is partly compensating for nitric oxide synthase 3 deficiency in nitric oxide synthase 3 knock-out mice and is elevated in murine and human cirrhosis.
15251453 2004 Calcium/calmodulin-dependent protein kinase I inhibits neuronal nitric-oxide synthase activity through serine 741 phosphorylation.
15242984 2004 Estrogen induces nitric oxide production via activation of constitutive nitric oxide synthases in human neuroblastoma cells.
15194886 2004 nNOS is involved in estrogen mediated neuroprotection in neuroblastoma cells.
15191553 2004 The neuronal nitric oxide synthase is upregulated in mouse skin repair and in response to epidermal growth factor in human HaCaT keratinocytes.
15180967 2004 Differential expression of nitric oxide synthases (NOS 1-3) in human skeletal muscle following exercise countermeasure during 12 weeks of bed rest.
15167446 2004 Genetic analysis of 22 candidate genes for hypertension in the Japanese population.
15161750 2004 Changes in the dimeric state of neuronal nitric oxide synthase affect the kinetics of secretagogue-induced insulin response.
15119548 2004 Intron 4 polymorphism of the endothelial nitric oxide synthase gene is associated with the development of lupus nephritis.
15105416 2004 NIDD, a novel DHHC-containing protein, targets neuronal nitric-oxide synthase (nNOS) to the synaptic membrane through a PDZ-dependent interaction and regulates nNOS activity.
15094474 2004 Expression of nNOS and soluble guanylate cyclase in schizophrenic brain.
15088155 2004 Association analysis of a neural nitric oxide synthase gene polymorphism and antipsychotics-induced tardive dyskinesia in Chinese schizophrenic patients.
15080837 2004 Neuronal nitric oxide synthase gene polymorphism and IgE-mediated allergy in the Central European population.
15075442 2004 Genetic association analysis of neuronal nitric oxide synthase gene polymorphism with tardive dyskinesia.
15044250 2004 Expression, localization, and regulation of NOS in human mast cell lines: effects on leukotriene production.
15033959 2004 Contribution of nNOS- and eNOS-derived NO to microvascular smooth muscle NO exposure.
14980078 2004 Posttranscriptional regulation of neuronal nitric oxide synthase expression by IFN-gamma.
14760158 2004 Nitric oxide synthase 1 as a potential modifier gene of decline in lung function in patients with cystic fibrosis.
14759629 2004 Investigation of a neuronal nitric oxide synthase gene (NOS1) polymorphism in a multiple sclerosis population.
14757827 2004 Single-nucleotide promoter polymorphism alters transcription of neuronal nitric oxide synthase exon 1c in infantile hypertrophic pyloric stenosis.
14752097 2004 1-Methyl-4-phenylpyridinium-induced apoptosis in cerebellar granule neurons is mediated by transferrin receptor iron-dependent depletion of tetrahydrobiopterin and neuronal nitric-oxide synthase-derived superoxide.
14711010 Interplay of Cu,Zn superoxide dismutase and nitric oxide synthase in neurodegenerative processes.
14623375 2003 Association analysis for the CA repeat polymorphism of the neuronal nitric oxide synthase (NOS1) gene and schizophrenia.
14615895 2003 Expression of nitric oxide synthases in keratinocytes after UVB irradiation.
14602725 2004 Nitric oxide inhibition of ERK1/2 activity in cells expressing neuronal nitric-oxide synthase.
12947326 2003 Inhibition of neural nitric oxide synthase attenuates the chloride secretory response to stroking in human jejunum.
12911502 2003 NOS1 polymorphism is associated with atopy but not exhaled nitric oxide levels in healthy children.
12908999 2003 Does endothelial nitric oxide synthase gene variation play a role in the occurrence of hypertension in pregnancy?
12816735 2003 Nitric oxide synthases and protein oxidation in the quadriceps femoris of patients with chronic obstructive pulmonary disease.
12802542 2003 Immunocytochemical distribution of nitric oxide synthase in the human seminal vesicle: a light and electron microscopical study.
12787407 2003 Expression of NOS1 and soluble guanylyl cyclase by human kidney epithelial cells: morphological evidence for an autocrine/paracrine action of nitric oxide.
12782337 2003 Simultaneous analysis of five genetic risk factors in Polish patients with Alzheimer's disease.
12777376 2003 Mechanistic studies on the intramolecular one-electron transfer between the two flavins in the human neuronal nitric-oxide synthase and inducible nitric-oxide synthase flavin domains.
12759556 2003 Association analysis for neuronal nitric oxide synthase gene polymorphism with major depression and fluoxetine response.
12715886 2003 Transcription of different exons 1 of the human neuronal nitric oxide synthase gene is dynamically regulated in a cell- and stimulus-specific manner.
12686399 2003 Cellular compartmentalization of phosphorylated eIF2alpha and neuronal NOS in human temporal lobe epilepsy with hippocampal sclerosis.
12646269 2003 Electron transfer is activated by calmodulin in the flavin domain of human neuronal nitric oxide synthase.
12630910 2003 Post-synaptic density-95 promotes calcium/calmodulin-dependent protein kinase II-mediated Ser847 phosphorylation of neuronal nitric oxide synthase.
12572877 2002 Polymorphisms of the IL-1beta and IL-1beta-inducible genes in ulcerative colitis.
12531780 2003 Effects of sex and of gene variants in constitutive nitric oxide synthases on exhaled nitric oxide.
12490535 2003 Association between Parkinson's disease and polymorphisms in the nNOS and iNOS genes in a community-based case-control study.
12485841 2002 Further immunohistochemical evidence for impaired NO signaling in the hypothalamus of depressed patients.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445599 Expression of nitric oxide synthase isoforms in human pregnant myometrium at term.
12421162 2002 Analysis of nitric oxide synthase genes in cluster headache.
12403769 2003 Translational regulation of human neuronal nitric-oxide synthase by an alternatively spliced 5'-untranslated region leader exon.
12237228 2002 Assembly and activation of heme-deficient neuronal NO synthase with various porphyrins.
12210288 2002 No association between the neuronal nitric oxide synthase gene polymorphism and Alzheimer Disease.
12140778 2002 Allelic association of the neuronal nitric oxide synthase (NOS1) gene with schizophrenia.
12081996 2002 Cardiac nitric oxide synthase 1 regulates basal and beta-adrenergic contractility in murine ventricular myocytes.
12081486 2002 Neuronal nitric oxide synthase ligand and protein vibrations at the substrate binding site. A study by FTIR.
11890749 2002 Nasal nitric oxide levels in cystic fibrosis patients are associated with a neuronal NO synthase (NOS1) gene polymorphism.
11849441 2002 Arginase in glomerulonephritis.
11849436 2002 Interactions between inducible nitric oxide synthase and heme oxygenase-1 in glomerulonephritis.
11747091 2001 Association of neuronal nitric oxide synthase (nNOS) with alpha1-syntrophin at the sarcolemma.
11668616 2001 Fine mapping and single nucleotide polymorphism association results of candidate genes for asthma and related phenotypes.
11591728 2001 The plasmamembrane calmodulin-dependent calcium pump: a major regulator of nitric oxide synthase I.
11590170 2001 Binding of neuronal nitric-oxide synthase (nNOS) to carboxyl-terminal-binding protein (CtBP) changes the localization of CtBP from the nucleus to the cytosol: a novel function for targeting by the PDZ domain of nNOS.
11546971 2001 Sepsis is associated with reciprocal expressional modifications of constitutive nitric oxide synthase (NOS) in human skeletal muscle: down-regulation of NOS1 and up-regulation of NOS3.
11525805 2001 No linkage or association of the nitric oxide synthase genes to multiple sclerosis.
11511520 2001 Neuronal nitric oxide synthase: a substrate for SHP-1 involved in sst2 somatostatin receptor growth inhibitory signaling.
11404282 2001 The influence of nitric oxide synthase 1 on blood flow and interstitial nitric oxide in the kidney.
11284722 2001 Heat-shock protein 90 augments neuronal nitric oxide synthase activity by enhancing Ca2+/calmodulin binding.
11149895 2001 NOSIP, a novel modulator of endothelial nitric oxide synthase activity.
11112111 2000 Exhaled nitric oxide in patients with asthma: association with NOS1 genotype.
11086993 2000 Dexras1: a G protein specifically coupled to neuronal nitric oxide synthase via CAPON.
11052978 2000 AMPK signaling in contracting human skeletal muscle: acetyl-CoA carboxylase and NO synthase phosphorylation.
11043403 2000 The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells.
10874031 2000 Inhibition of neuronal nitric-oxide synthase by calcium/ calmodulin-dependent protein kinase IIalpha through Ser847 phosphorylation in NG108-15 neuronal cells.
10824095 2000 Formation of a native-like beta-hairpin finger structure of a peptide from the extended PDZ domain of neuronal nitric oxide synthase in aqueous solution.
10681501 2000 Interaction of endothelial and neuronal nitric-oxide synthases with the bradykinin B2 receptor. Binding of an inhibitory peptide to the oxygenase domain blocks uncoupled NADPH oxidation.
10518591 1999 RNA diversity has profound effects on the translation of neuronal nitric oxide synthase.
10488080 1999 PSD-95 assembles a ternary complex with the N-methyl-D-aspartic acid receptor and a bivalent neuronal NO synthase PDZ domain.
10400690 1999 Regulation of neuronal nitric-oxide synthase by calmodulin kinases.
10221915 1999 Unexpected modes of PDZ domain scaffolding revealed by structure of nNOS-syntrophin complex.
10187848 1999 Interaction of neuronal nitric-oxide synthase and phosphofructokinase-M.
9892689 1999 Nitric oxide synthase in cardiac sarcoplasmic reticulum.
9837926 1998 Protein inhibitor of neuronal nitric-oxide synthase, PIN, binds to a 17-amino acid residue fragment of the enzyme.
9808772 1998 Binding of dynein light chain (PIN) to neuronal nitric oxide synthase in the absence of inhibition.
9791007 1998 Isolation and characterization of a novel, human neuronal nitric oxide synthase cDNA.
9459447 1998 CAPON: a protein associated with neuronal nitric oxide synthase that regulates its interactions with PSD95.
9353265 1997 Interaction of neuronal nitric-oxide synthase with caveolin-3 in skeletal muscle. Identification of a novel caveolin scaffolding/inhibitory domain.
9111048 1997 A novel, testis-specific mRNA transcript encoding an NH2-terminal truncated nitric-oxide synthase.
8922396 1996 Cloning and characterization of postsynaptic density 93, a nitric oxide synthase interacting protein.
8879752 1996 Neuronal isoform of nitric oxide synthase is expressed at low levels in human retina.
8864115 1996 PIN: an associated protein inhibitor of neuronal nitric oxide synthase.
8625413 1996 Interaction of nitric oxide synthase with the postsynaptic density protein PSD-95 and alpha1-syntrophin mediated by PDZ domains.
7685260 1993 Regional localization of the gene coding for human brain nitric oxide synthase (NOS1) to 12q24.2-->24.31 by fluorescent in situ hybridization.
7682706 1993 Molecular cloning and expression of inducible nitric oxide synthase from human hepatocytes.
7678401 1993 Cloned human brain nitric oxide synthase is highly expressed in skeletal muscle.
7558036 1995 Three members of the nitric oxide synthase II gene family (NOS2A, NOS2B, and NOS2C) colocalize to human chromosome 17.
7545544 1995 Nitric oxide synthase complexed with dystrophin and absent from skeletal muscle sarcolemma in Duchenne muscular dystrophy.
7528745 1994 Structural organization of the human neuronal nitric oxide synthase gene (NOS1).
7515942 1994 Expression of two types of nitric oxide synthase mRNA in human neuroblastoma cell lines.
7488039 1995 Cysteine 99 of endothelial nitric oxide synthase (NOS-III) is critical for tetrahydrobiopterin-dependent NOS-III stability and activity.
1689048 1990 Isolation of nitric oxide synthetase, a calmodulin-requiring enzyme.
1385308 1992 Localization of brain nitric oxide synthase (NOS) to human chromosome 12.
1379716 1992 Cloned and expressed macrophage nitric oxide synthase contrasts with the brain enzyme.
1375933 1992 Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites.