Property Summary

NCBI Gene PubMed Count 25
PubMed Score 27.71
PubTator Score 17.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.9e-10
acute quadriplegic myopathy 1157 2.4e-07
ovarian cancer 8491 1.1e-02
Disease Target Count Z-score Confidence
Kennedy's disease 13 3.083 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.037 1.9e-10
acute quadriplegic myopathy 1.393 2.4e-07
ovarian cancer 1.500 1.1e-02

Gene RIF (4)

PMID Text
22174317 HIV-1 Rev interacting protein, ribonucleoprotein homolog (NOP58), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NOP58 is increased by RRE
20797632 SUMOylation is essential for high-affinity Nop58 binding to small nucleolar riboproteins.
19620283 snoRNP assembly factor NUFIP can regulate the interactions between TIP48 and TIP49 and the core box C/D proteins.
12032086 Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments.

AA Sequence

MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINK      1 - 70
QLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCL     71 - 140
GLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQK    141 - 210
VGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMM    211 - 280
AIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQT    281 - 350
SPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE    351 - 420
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKR    421 - 490
GKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED                                   491 - 529
//

Text Mined References (43)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25074380 2014 Identification of discrete classes of small nucleolar RNA featuring different ends and RNA binding protein dependency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21522132 2011 CRM1 controls the composition of nucleoplasmic pre-snoRNA complexes to licence them for nucleolar transport.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20797632 2010 A proteomic screen for nucleolar SUMO targets shows SUMOylation modulates the function of Nop5/Nop58.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19620283 2009 Evidence that the AAA+ proteins TIP48 and TIP49 bridge interactions between 15.5K and the related NOP56 and NOP58 proteins during box C/D snoRNP biogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17709390 2007 Involvement of nuclear import and export factors in U8 box C/D snoRNP biogenesis.
17636026 2007 A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16687569 2006 Ongoing U snRNP biogenesis is required for the integrity of Cajal bodies.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15635413 2005 Nucleolar proteome dynamics.
15574333 2004 Assembly and maturation of the U3 snoRNP in the nucleoplasm in a large dynamic multiprotein complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12417735 2002 Conserved stem II of the box C/D motif is essential for nucleolar localization and is required, along with the 15.5K protein, for the hierarchical assembly of the box C/D snoRNP.
12032086 2002 Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10925205 2000 Isolation and characterization of a novel PDGF-induced human gene.
10679015 2000 Conserved composition of mammalian box H/ACA and box C/D small nucleolar ribonucleoprotein particles and their interaction with the common factor Nopp140.
10648622 2000 Spb1p is a yeast nucleolar protein associated with Nop1p and Nop58p that is able to bind S-adenosyl-L-methionine in vitro.
10606270 1999 Human Nop5/Nop58 is a component common to the box C/D small nucleolar ribonucleoproteins.