Property Summary

NCBI Gene PubMed Count 33
PubMed Score 40.68
PubTator Score 22.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.128 8.6e-06
colon cancer 1.500 6.5e-06
gastric carcinoma 1.400 1.6e-02
lung cancer 1.700 3.0e-04
osteosarcoma -1.691 1.9e-04
ovarian cancer 2.200 2.2e-05
Waldenstrons macroglobulinemia 1.093 3.4e-03

Protein-protein Interaction (8)

Gene RIF (8)

AA Sequence

MVLLHVLFEHAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVALENANAVSEG      1 - 70
VVHEDLRLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLS     71 - 140
ACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIINDNATY    141 - 210
CRLAQFIGNRRELNEDKLEKLEELTMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQS    211 - 280
LHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGL    281 - 350
IFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDV    351 - 420
MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEV    421 - 490
PQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKR    491 - 560
KFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED                                        561 - 594
//

Text Mined References (46)

PMID Year Title