Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.15
PubTator Score 4.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 1.2e-02
ependymoma -1.100 3.7e-02
lung cancer 2.500 2.8e-04
colon cancer 1.600 2.3e-04
non primary Sjogren syndrome sicca 1.100 1.2e-02
invasive ductal carcinoma -1.059 2.2e-02
nasopharyngeal carcinoma 1.100 6.3e-04
ovarian cancer 1.300 1.2e-04

Synonym

Accession Q9Y3C1 B4DV13 D6RGD3 Q05D05 Q6IAI6 Q6PIM0 Q8IXL5
Symbols HSPC111
HSPC185

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

PMID Text
24425784 RNA 3'-phosphate cyclase (RTCD1/RTCA) interacted with HSPC111, and RTCD1 was involved in the HSPC111 multiprotein complex in regulating rRNA production and ribosomal biogenesis.
18373870 HSPC111 is an estrogen and c-Myc target gene that is over-expressed in breast cancer and is associated with an adverse patient outcome.

AA Sequence

MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK      1 - 70
RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY     71 - 140
YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE                                    141 - 178
//

Text Mined References (19)

PMID Year Title
24425784 2014 HSPC111 governs breast cancer growth by regulating ribosomal biogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18373870 2008 The estrogen and c-Myc target gene HSPC111 is over-expressed in breast cancer and associated with poor patient outcome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.