Property Summary

NCBI Gene PubMed Count 43
PubMed Score 44.46
PubTator Score 159.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.333 9.2e-04
Multiple myeloma 1.187 3.7e-04
malignant mesothelioma 1.400 8.4e-07
psoriasis 3.300 2.3e-05
cutaneous lupus erythematosus 1.200 1.3e-03
osteosarcoma 1.528 1.3e-04
atypical teratoid / rhabdoid tumor 1.100 2.8e-06
medulloblastoma, large-cell 2.200 1.3e-04
acute quadriplegic myopathy 1.094 2.7e-08
lung cancer 1.400 2.4e-04
colon cancer 1.600 1.9e-04
subependymal giant cell astrocytoma -1.073 1.6e-02
invasive ductal carcinoma 1.400 1.2e-03
dermatomyositis 1.100 6.5e-04

Gene RIF (19)

PMID Text
25645906 D120 and R195 of H5N1 influenza virus NS1 were crucial for the binding to host NOLC1.
25205458 pRb2/p130 cytoplasmic delocalization can lead to cell cycle deregulation
24218616 A Nopp140 fragment (residues 568-596) and inositol hexakisphosphate competitively bind to the catalytic subunit of CK2 (CK2alpha), and phospho-Ser574 of Nopp140 significantly enhances its interaction with CK2alpha.
23970161 our study demonstrated that DNA methylation is a key mechanism of silenced NOLC1 expression in human hepatocellular carcinoma cells, and NOLC1 gene hypermethylation of the four CpG dinucleotides is a potential biomarker for hepatocellular carcinoma.
23188192 H5N1 viral NS1 interacts with host NOLC1 protein.
22906532 Structural disorder and local order of hNopp140
22190034 HIV-1 MA is identified to have a physical interaction with nucleolar and coiled-body phosphoprotein 1 (NOLC1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21266110 The regulation of NOCL1 protein is a critical role for the transcription NF-kB and cAMP response element-bing protein
19541936 both NOLC1 and tumor protein 53 work together synergistically to activate the MDM2 promoter in NPC cells.
19381672 Nopp140 could be a component implicated in the early steps of pre-rRNA processing.
19129172 The functional deficiency in spinal muscular atrophy cells is associated with decreased localization of the snoRNP chaperone Nopp140 in Cajal bodies that correlates with disease severity.
18790693 InsP(6) specifically binds to CK2alpha and disrupts the interaction between CK2alpha and Nopp140 with an IC(50) value of 25 microM, thereby attenuating the Nopp140-mediated repression of CK2 activity.
18253863 hNopp140, a scaffold protein, is involved in the nucleolar assembly, fusion, and maintenance
17531812 Evolutionarily conserved multisubunit protein complex that contains p130 and E2F4 mediates the repression of cell cycle-dependent genes in quiescence.
17038328 hNopp140 serves as a negative regulator of CK2 and InsP(6) stimulates the activity of CK2 by blocking the interaction between hNopp140 and CK2
17001309 Hypoxia induces substantial p130 dephosphorylation and nuclear accumulation, leading to the formation of E2F4/p130 complexes and increased occupancy of E2F4 and p130 at the RAD51 and BRCA1 promoters.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12446766 These data show that Nopp140 reversibly associates with snoRNPs in a phosphorylation-dependent manner, but this association has no effect on pseudouridylation of rRNA.
12167624 NOPP140 is involved in a PKA signaling pathway that leads to agp activation

AA Sequence

MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQA      1 - 70
NGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAAAKASESSSSEESSDDDDEED     71 - 140
QKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPPKNQKPKITPVTVKAQTKAPPKPARAAPKIA    141 - 210
NGKAASSSSSSSSSSSSDDSEEEKAAATPKKTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKK    211 - 280
PMKNKPGPYSSVPPPSAPPPKKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATT    281 - 350
KPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRK    351 - 420
ADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAV    421 - 490
KKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAA    491 - 560
KNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVRE    561 - 630
EEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE     631 - 699
//

Text Mined References (62)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25645906 2015 Identification of NS1 domains of avian H5N1 influenza virus which influence the interaction with the NOLC1 protein.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25205458 2015 pRb2/p130 localizes to the cytoplasm in diffuse gastric cancer.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24218616 2013 Structural and functional insights into the regulation mechanism of CK2 by IP6 and the intrinsically disordered protein Nopp140.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23970161 2013 Methylation of nucleolar and coiled-body phosphoprotein 1 is associated with the mechanism of tumorigenesis in hepatocellular carcinoma.
23188192 2013 Interaction of avian influenza virus NS1 protein and nucleolar and coiled-body phosphoprotein 1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22906532 2013 Structural disorder and local order of hNopp140.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21266110 2011 Identification of nucleolar and coiled-body phosphoprotein 1 (NOLC1) minimal promoter regulated by NF-?B and CREB.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19541936 2009 NOLC1, an enhancer of nasopharyngeal carcinoma progression, is essential for TP53 to regulate MDM2 expression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19381672 2009 Localization of Nopp140 within mammalian cells during interphase and mitosis.
19129172 2009 The loss of the snoRNP chaperone Nopp140 from Cajal bodies of patient fibroblasts correlates with the severity of spinal muscular atrophy.
18790693 2008 Characterization of the InsP6-dependent interaction between CK2 and Nopp140.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18253863 2008 Chromatin tethering effects of hNopp140 are involved in the spatial organization of nucleolus and the rRNA gene transcription.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17038328 2006 Protein kinase CK2 is inhibited by human nucleolar phosphoprotein p140 in an inositol hexakisphosphate-dependent manner.
17001309 2007 Repression of RAD51 gene expression by E2F4/p130 complexes in hypoxia.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446766 2002 Immunopurified small nucleolar ribonucleoprotein particles pseudouridylate rRNA independently of their association with phosphorylated Nopp140.
12167624 2002 Nopp140 is a mediator of the protein kinase A signaling pathway that activates the acute phase response alpha1-acid glycoprotein gene.
10567578 1999 Human Nopp140, which interacts with RNA polymerase I: implications for rRNA gene transcription and nucleolar structural organization.
9016786 1997 The nucleolar phosphoprotein P130 is a GTPase/ATPase with intrinsic property to form large complexes triggered by F- and Mg2+.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8630004 1996 Cell proliferation-dependent expression of two isoforms of the nucleolar phosphoprotein p130.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7657714 1995 Cell-cycle-dependent alterations of a highly phosphorylated nucleolar protein p130 are associated with nucleologenesis.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.