Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.05
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.6e-06
colon cancer -1.700 4.0e-02
glioblastoma 1.200 2.5e-04
medulloblastoma, large-cell 1.500 2.7e-04
osteosarcoma 3.116 1.7e-10
pediatric high grade glioma 1.200 8.5e-06
Pick disease 1.100 2.0e-05
psoriasis -1.500 6.8e-05

Gene RIF (2)

AA Sequence

MADSGLLLKRGSCRSTWLRVRKARPQLILSRRPRRRLGSLRWCGRRRLRWRLLQAQASGVDWREGARQVS      1 - 70
RAAAARRPNTATPSPIPSPTPASEPESEPELESASSCHRPLLIPPVRPVGPGRALLLLPVEQGFTFSGIC     71 - 140
RVTCLYGQVQVFGFTISQGQPAQDIFSVYTHSCLSIHALHYSQPEKSKKELKREARNLLKSHLNLDDRRW    141 - 210
SMQNFSPQCSIVLLEHLKTATVNFITSYPGSSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTES    211 - 280
TLSALEELVNVSCEEVDGCPVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISL    281 - 350
LNITEPVLGPPFTHLRTPQKMVYYGKPSCKNNYENYIDIVKYVFSAYKRESPLIVNTMGWVSDQGLLLLI    351 - 420
DLIRLLSPSHVVQFRSDHSKYMPDLTPQYVDDMDGLYTKSKTKMRNRRFRLAAFADALEFADEEKESPVE    421 - 490
FTGHKLIGVYTDFAFRITPRNRESHNKILRDLSILSYLSQLQPPMPKPLSPLHSLTPYQVPFNAVALRIT    491 - 560
HSDVAPTHILYAVNASWVGLCKIQDDVRGYTNGPILLAQTPICDCLGFGICRGIDMEKRLYHILTPVPPE    561 - 630
ELRTVNCLLVGAIAIPHCVLKCQRGIEGTVPYVTTDYNFKLPGASEKIGAREPEEAHKEKPYRRPKFCRK    631 - 700
MK                                                                        701 - 702
//

Text Mined References (20)

PMID Year Title