Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.45
PubTator Score 8.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.032 4.5e-03
Multiple myeloma 1.190 6.7e-03
psoriasis 1.200 2.4e-04
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-03
lung cancer 2.200 4.4e-05
ovarian cancer 2.500 2.9e-05
dermatomyositis 1.200 2.1e-04

Synonym

Accession Q9UMY1 Q5T297 Q9Y3U7
Symbols PQBP3
RARG-1
C6orf90
dJ223E5.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
23085760 NOL7 significantly alters TSP-1 expression and may be a master regulator that coordinates the post-transcriptional expression of key signaling factors critical for the regulation of the angiogenic phenotype.
22123719 NOL7 is the legitimate tumor suppressor gene located on 6p23.
21818416 Three alternatively spliced forms of the human NOL7 gene coding for relatively small proteins were identified
20206243 determined that the essential elements required for the optimal promoter activity of NOL7 were 560 bp upstream of its translation start site.

AA Sequence

MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFA      1 - 70
SAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEV     71 - 140
NLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNK    141 - 210
FLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK                           211 - 257
//

Text Mined References (20)

PMID Year Title
23308053 2012 The RB tumor suppressor positively regulates transcription of the anti-angiogenic protein NOL7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085760 2013 The novel tumor suppressor NOL7 post-transcriptionally regulates thrombospondin-1 expression.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22123719 2012 Characterization of NOL7 gene point mutations, promoter methylation, and protein expression in cervical cancer.
21818416 The dynamics of the alternatively spliced NOL7 gene products and role in nucleolar architecture.
20875127 2010 Identification and functional analysis of NOL7 nuclear and nucleolar localization signals.
20206243 2010 Identification and characterization of the human NOL7 gene promoter.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16205646 2006 NOL7 is a nucleolar candidate tumor suppressor gene in cervical cancer that modulates the angiogenic phenotype.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9875212 1998 Polar amino acid-rich sequences bind to polyglutamine tracts.