Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.39
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96MY1 Q5JYB7 Q6P0Y4 Q9BR34 Q9NQF6
Symbols C20orf112
C20orf113
dJ1184F4.2
dJ1184F4.4

Gene

Gene RIF (2)

PMID Text
21765475 the leukemogenic PAX5-C20S fusion protein is a tetramer, which interacts extraordinarily stably with chromatin as determined by Fluorescence Recovery After Photobleaching in living cells
20520637 report characterization of two chimeric transcripts identified in AML translocation cases involving CBFA2T2 and C20orf112

AA Sequence

MSDSTWMSADPHLASSLSPSQDERMRSPQNLHSQEDDDSSSESGSGNGSSTLNPSTSSSTQGDPAFPEMN      1 - 70
GNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDS     71 - 140
IKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERLKAFNMFVRLFVDENLDRMVPISK    141 - 210
QPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKKNGMEMTRPTPPHLTSAMAENILAAACESET    211 - 280
RKAAKRMRLEIYQSSQDEPIALDKQHSRDSAAITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNL    281 - 350
QPPASLQTGNHSNGPTDLSMKGGASTTSTTPTPTPSSTSTSRPVPTAQLSPTEISAVRQLIAGYRESAAF    351 - 420
LLRSADELENLILQQN                                                          421 - 436
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21765475 2012 Dominant-negative mechanism of leukemogenic PAX5 fusions.
20520637 2010 CBFA2T2 and C20orf112: two novel fusion partners of RUNX1 in acute myeloid leukemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.