Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.09
PubTator Score 1.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7766 7.8e-04
lung cancer 4607 8.5e-04
psoriasis 6514 2.0e-03
interstitial lung disease 287 2.6e-02

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial lung disease 1.200 2.6e-02
lung cancer 1.400 8.5e-04
osteosarcoma -1.144 7.8e-04
psoriasis 1.400 2.0e-03

Synonym

Accession Q9UGY1
Symbols Nop25
dJ37E16.7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLK      1 - 70
MLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASS     71 - 140
TEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARH    141 - 210
SGE                                                                       211 - 213
//

Text Mined References (16)

PMID Year Title