Property Summary

NCBI Gene PubMed Count 88
PubMed Score 783.11
PubTator Score 295.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma 1.400 2.7e-05
osteosarcoma -2.161 1.9e-04
medulloblastoma -2.000 1.5e-02
medulloblastoma, large-cell -2.200 3.6e-03
adult high grade glioma -1.100 2.6e-02
atypical teratoid/rhabdoid tumor 1.500 3.6e-03
sarcoidosis -2.100 1.0e-05
mucosa-associated lymphoid tissue lympho... -1.205 2.1e-02

Gene RIF (56)

PMID Text
26413886 An imbalance between BMP-2 and Noggin secretion induces abnormal osteogenic differentiation of ankylosing spondylitis-mesenchymal stem cells.
26383864 early noggin exposure may play a specific role in the directed differentiation of DA cells from human embryonic stem cells.
25888563 Novel p.W150C NOG mutation associated with proximal symphalangism and conductive hearing impairment was identified in a Chinese family.Impaired dimerization of mutant NOG is an important pathogenic mechanism for the NOG-related disorder.
25391606 By next-generation and Sanger sequencing analyses, study identified two novel mutations, c.559C>G (p.P178A) and c.682T>A (p.C228S), in the proximal symphalangism and atypical multiple synostosis syndrome families, respectively.
25339627 No association between SPRY2, single-nucleotide polymorphisms, and nonsyndromic cleft lip with or without cleft palate risk were observed in this cohort of patients.
24735539 this study proposes that the decreased binding affinity of NOG with the p.R136C mutation to HSPG leads to an excess of bone morphogenetic protein signaling and underlies the proximal symphalangism and conductive hearing loss phenotype of carriers.
24706492 The study did not provide support for NOG being the causal gene at 17q22 in nonsyndromic cleft lip with or without cleft palate.
24326127 a novel NOG mutation in a Chinese family with proximal symphalangism
24170657 High-quality studies show that otosclerosis in Japanese patients is not linked to the NOG gene. [Review]
23826422 Even though gremlin 1 and noggin were not widely expressed in adult tissues, in a subset of organs their expression pattern indicated a potential role in normal tissue homeostasis as well as in malignancies.
23732071 A novel heterozygous change of p. R42T [c.C124A (CCC > ACC)] leading to a proline was identified in a family with multiple synostoses syndrome.
23483047 NOggin attenuates BMP4-mediated transdifferentiation of human valve interstitial cells towards an osteogenic-like phenotype in aortic valve sclerosis.
22740073 Noggin suppression decreased viability and BMP-2-induced osteogenic differentiation of human mesenchymal stem cells.
22628200 BMP2 treatment reduced noggin expression, which resulted in increased expression of apoptotic markers and increased apoptosis of osteoblasts.
22621191 Human squamous cell carcinomas and malignant melanomas contain significantly more Myo/Nog cells than basal cell carcinomas.
22547073 Using genetic approaches, we show that when NOG is expressed in human breast cancer cells, it facilitates bone colonization by fostering osteoclast differentiation and bone degradation and also contributes to metastatic lesions reinitiation.
22529972 p.G92E represents a rare polymorphism of the NOGGIN gene-- causing neither brachydactyly nor fibrodysplasia ossificans progressiva.
22503063 we conclude that mutations in the coding region of NOG are rare, and play at most an uncommon role in human Holoprosencephaly (HPE).
22364398 high BMP6 activity, defined by strong BMP6 expression with weak noggin or SOST expression, was associated with shorter survival in esophageal SCC patients; results suggest BMP6, noggin and SOST could be used in combination as a prognostic indicator in cancer progression
22288654 Mutations in the NOG gene are commonly found in congenital stapes ankylosis with symphalangism, but not in otosclerosis.
22083168 SNPs in the coding region of the NOG gene are identified infrequently in human cases of EA/TEF
21249149 evidence for a model of osteolytic bone metastasis where constitutive secretion of noggin by cancer cells mediates inhibition of bone formation, thereby preventing repair of osteolytic lesions generated by an excess of osteoclast-mediated bone resorption.
21111488 secreted levels of noggin were decreased in untreated patients with relapsing-remitting Multiple sclerosis
20734064 Observational study of gene-disease association. (HuGE Navigator)
20645637 This result suggests that there may be population polymorphism, or markers that are seldom polymorphic for our population
20546612 Observational study of gene-disease association. (HuGE Navigator)
20503332 study reports on a family with facioaudiosymphalangism syndrome with overgrowth due to a novel heterozygous NOG missense mutation (c.696C > G, p.Cys232Trp)
20048150 Using BMP-6/7 chimeras, we identified lysine 60 as a key residue conferring noggin resistance within the BMP-6 protein.
19700758 tumor suppressor activity of the BMPs in skin epithelium depends on the local concentrations of noggin and is mediated at least in part via stage-dependent antagonizing of Wnt and Shh signaling pathways
19692649 This study showed that constitutive and orthotopic Noggin protein expression did not influence cell proliferation, down-regulated BMP-2 expression, and showed no effect on BMP receptor transcripts.
19597895 Data suggest inhibition of BMP-7, by Drm (Gremlin), follistatin, and Noggin and upregulation of BMP-4 may play an integral role in the development of nonunions.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19400542 NOG & 617G>A activin A type I receptor(ACVRI)mutations in 27 fibrodysplasia ossificans patients; 5 NOG mutations found in 7 patients; 617G>A mutation in ACVR1 gene found in 14 patients; with 1 exception, 617G>A & NOG mutations were mutually exclusive
19167531 The analysis suggests that a common variation in the noggin gene is unlikely to have a major impact on BMD among older men of African ancestry.
19167531 Observational study of gene-disease association. (HuGE Navigator)
19058174 there was no difference in the expression of noggin and chordin between healing and nonhealing fractures
19023570 Noggin and chordin were also expressed most intensely in areas of cartilage formation and there was no difference in their expression between the non-hypertrophic and hypertrophic chondrocytes.
18931653 the potential use of bone-morphogenetic protein-6, noggin and sclerostin expression together as a prognostic predictor for metastatic progression of prostate cancer.
18560367 Advanced melanoma cells may escape from BMP7-induced inhibition through concomitant aberrant expression of Noggin.
18537141 Transgenic noggin overexpression increases the total number of neurons in the colon; the density of colonic neurons increases significantly in both Nog/+ and Nog/Nog mice, although the two groups of transgenic animals do not differ significantly.
18204269 Heterozygous gene mutations in NOGGIN are associated with tall stature in children but not necessarily in adults.
18019378 Various mutations may occur in myositis ossificans nuclear families.
17889703 NOG is involved in myeloproliferative disease associated with myelofibrosis
17696196 Expression analysis of additional genes, AKT1, NOG and its antagonist BMP4, which interact downstream to FGFR1, demonstrated expression differences between primary rhabdomyosarcoma tumors and normal skeletal muscles
17218603 Antagonism of bone morphogenetic protein signaling by transgenic Noggin plays a critical role in ensuring proper levels of cell proliferation and epithelial-to-mesenchymal transformation during cardiac morphogenesis.
17200191 Lack of noggin expression by cancer cells may be a relevant mechanism contributing to the osteoblast response in bone metastases
17138967 Data show calcium-sensing receptor stimulation of T-84 epithelia and colonic myofibroblasts downregulated the BMP family antagonist Noggin.
16126463 Overexpression of noggin in PC-3 cells inhibited the expansion of the lesion in vivo.
15756420 These studies highlight the critical role played by Cys168 in noggin's biological activities.
15264296 Mutations in the nog gene have been identified.
14999064 Here, we show that the overexpression of human noggin, by acting to inhibit glial differentiation by subependymal progenitor cells, can potentiate adenoviral BDNF-mediated recruitment of new neurons to the adult rat neostriatum
12621334 Nog gene is connected to stapes ankylosis.
12478285 crystal structure of the antagonist Noggin bound to BMP-7, which shows that Noggin inhibits BMP signalling by blocking the molecular interfaces of the binding epitopes for both type I and type II receptors
12404109 Observational study of gene-disease association. (HuGE Navigator)
12089654 Autosomal dominant stapes ankylosis with broad thumbs and toes, hyperopia, and skeletal anomalies is caused by heterozygous nonsense and frameshift mutations in NOG, the gene encoding noggin
11857750 A novel NOG gene mutation giving rise to the (P35S) amino acid substitution has been identified in an Italian family with symphalangism.

AA Sequence

MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLL      1 - 70
GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKK     71 - 140
LRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRR    141 - 210
GGQRCGWIPIQYPIISECKCSC                                                    211 - 232
//

Text Mined References (91)

PMID Year Title
26643732 2016 A New Subtype of Multiple Synostoses Syndrome Is Caused by a Mutation in GDF6 That Decreases Its Sensitivity to Noggin and Enhances Its Potency as a BMP Signal.
26413886 2016 Imbalance Between Bone Morphogenetic Protein 2 and Noggin Induces Abnormal Osteogenic Differentiation of Mesenchymal Stem Cells in Ankylosing Spondylitis.
26383864 2015 Noggin Over-Expressing Mouse Embryonic Fibroblasts and MS5 Stromal Cells Enhance Directed Differentiation of Dopaminergic Neurons from Human Embryonic Stem Cells.
25888563 2015 A Novel Missense Mutation of NOG Interferes With the Dimerization of NOG and Causes Proximal Symphalangism Syndrome in a Chinese Family.
25391606 2015 Identification of two novel mutations in the NOG gene associated with congenital stapes ankylosis and symphalangism.
25339627 2015 Association between NOGGIN and SPRY2 polymorphisms and nonsyndromic cleft lip with or without cleft palate.
24735539 2014 A mutation in the heparin-binding site of noggin as a novel mechanism of proximal symphalangism and conductive hearing loss.
24706492 2014 Nonsyndromic cleft lip with or without cleft palate: Increased burden of rare variants within Gremlin-1, a component of the bone morphogenetic protein 4 pathway.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24326127 2014 Identification of a novel NOG mutation in a Chinese family with proximal symphalangism.
24170657 2014 An introduction of genetics in otosclerosis: a systematic review.
24098149 2013 A GDF5 point mutation strikes twice--causing BDA1 and SYNS2.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23826422 2013 The expression patterns of gremlin 1 and noggin in normal adult and tumor tissues.
23732071 2013 Multiple synostoses syndrome in three members of a family displaying a novel mutation in NOGGIN gene.
23483047 2013 Noggin attenuates the osteogenic activation of human valve interstitial cells in aortic valve sclerosis.
22740073 2012 Noggin suppression decreases BMP-2-induced osteogenesis of human bone marrow-derived mesenchymal stem cells in vitro.
22628200 2012 BMP2 induces osteoblast apoptosis in a maturation state and noggin-dependent manner.
22621191 2012 Myo/Nog cells in normal, wounded and tumor-bearing skin.
22547073 2012 Identification of NOG as a specific breast cancer bone metastasis-supporting gene.
22529972 2012 Functional analysis of alleged NOGGIN mutation G92E disproves its pathogenic relevance.
22503063 2012 Molecular analysis of the Noggin (NOG) gene in holoprosencephaly patients.
22364398 2012 Combinatorial use of bone morphogenetic protein 6, noggin and SOST significantly predicts cancer progression.
22288654 2012 Mutations in the NOG gene are commonly found in congenital stapes ankylosis with symphalangism, but not in otosclerosis.
22083168 2012 Mutational analysis of NOG in esophageal atresia and tracheoesophageal fistula patients.
21976273 2012 New insights into the molecular mechanism of multiple synostoses syndrome (SYNS): mutation within the GDF5 knuckle epitope causes noggin-resistance.
21249149 2011 The role of the BMP signaling antagonist noggin in the development of prostate cancer osteolytic bone metastasis.
21111488 2011 Reduced production of noggin by immune cells of patients with relapsing-remitting multiple sclerosis.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20675382 2010 CYR61 regulates BMP-2-dependent osteoblast differentiation through the {alpha}v{beta}3 integrin/integrin-linked kinase/ERK pathway.
20645637 2010 Polymorphisms of the noggin gene and mandibular micrognathia: a first approximation.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20503332 2010 Facioaudiosymphalangism syndrome and growth acceleration associated with a heterozygous NOG mutation.
20048150 2010 Identification of a key residue mediating bone morphogenetic protein (BMP)-6 resistance to noggin inhibition allows for engineered BMPs with superior agonist activity.
20023658 2010 Genome-wide association study identifies two susceptibility loci for nonsyndromic cleft lip with or without cleft palate.
19804412 2009 The pro-form of BMP-2 interferes with BMP-2 signalling by competing with BMP-2 for IA receptor binding.
19700758 2009 Bone morphogenetic protein antagonist noggin promotes skin tumorigenesis via stimulation of the Wnt and Shh signaling pathways.
19692649 2009 In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells.
19597895 2009 Levels of expression for BMP-7 and several BMP antagonists may play an integral role in a fracture nonunion: a pilot study.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19400542 2009 Mutations of the noggin (NOG) and of the activin A type I receptor (ACVR1) genes in a series of twenty-seven French fibrodysplasia ossificans progressiva (FOP) patients.
19167531 2009 Identification and association analysis of single nucleotide polymorphisms in the human noggin (NOG) gene and osteoporosis phenotypes.
19058174 2009 Altered relative expression of BMPs and BMP inhibitors in cartilaginous areas of human fractures progressing towards nonunion.
19023570 2009 Regional and cellular localisation of BMPs and their inhibitors' expression in human fractures.
18931653 2008 The prognostic significance of BMP-6 signaling in prostate cancer.
18560367 2008 Aggressive melanoma cells escape from BMP7-mediated autocrine growth inhibition through coordinated Noggin upregulation.
18537141 2008 Bone morphogenetic protein regulation of enteric neuronal phenotypic diversity: relationship to timing of cell cycle exit.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18204269 2008 Growth and skeletal development in families with NOGGIN gene mutations.
18019378 2007 Mutations of the noggin and of the activin A type I receptor genes in fibrodysplasia ossificans progressiva (FOP).
17889703 2007 Bone morphogenetic protein antagonist gene NOG is involved in myeloproliferative disease associated with myelofibrosis.
17696196 2007 FGFR1 over-expression in primary rhabdomyosarcoma tumors is associated with hypomethylation of a 5' CpG island and abnormal expression of the AKT1, NOG, and BMP4 genes.
17668388 2007 A new subtype of brachydactyly type B caused by point mutations in the bone morphogenetic protein antagonist NOGGIN.
17218603 2007 The bone morphogenetic protein antagonist noggin regulates mammalian cardiac morphogenesis.
17200191 2007 Lack of noggin expression by cancer cells is a determinant of the osteoblast response in bone metastases.
17138967 2007 The extracellular calcium-sensing receptor reciprocally regulates the secretion of BMP-2 and the BMP antagonist Noggin in colonic myofibroblasts.
17029022 2006 Bone morphogenetic proteins and their antagonists.
16532400 2006 GDF5 is a second locus for multiple-synostosis syndrome.
16151340 2005 Stapes ankylosis in a family with a novel NOG mutation: otologic features of the facioaudiosymphalangism syndrome.
16126463 2006 Overexpression of noggin inhibits BMP-mediated growth of osteolytic prostate cancer lesions.
15770128 2005 The facio-audio-symphalangism syndrome in a four generation family with a nonsense mutation in the NOG-gene.
15756420 2005 Critical role of Cys168 in noggin protein's biological function.
15621726 2004 Bone morphogenetic proteins.
15539560 2005 Skeletal overexpression of gremlin impairs bone formation and causes osteopenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15264296 2004 A novel NOG mutation Pro37Arg in a family with tarsal and carpal synostoses.
14999064 2004 Adenovirally expressed noggin and brain-derived neurotrophic factor cooperate to induce new medium spiny neurons from resident progenitor cells in the adult striatal ventricular zone.
12621334 2003 Characterization of a stapes ankylosis family with a NOG mutation.
12478285 2002 Structural basis of BMP signalling inhibition by the cystine knot protein Noggin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12404109 2002 Evaluation of BMP4 and its specific inhibitor NOG as candidates in human neural tube defects (NTDs).
12115893 2002 Activin and bone morphogenetic proteins are present in perinatal sensory neuron target tissues that induce neuropeptides.
12089654 2002 Autosomal dominant stapes ankylosis with broad thumbs and toes, hyperopia, and skeletal anomalies is caused by heterozygous nonsense and frameshift mutations in NOG, the gene encoding noggin.
11857750 2002 Identification of a novel NOG gene mutation (P35S) in an Italian family with symphalangism.
11846737 2001 Mutations of the NOG gene in individuals with proximal symphalangism and multiple synostosis syndrome.
11706034 2002 Heparan sulfate proteoglycans retain Noggin at the cell surface: a potential mechanism for shaping bone morphogenetic protein gradients.
11580864 2001 Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons.
11562478 2001 Human disease-causing NOG missense mutations: effects on noggin secretion, dimer formation, and bone morphogenetic protein binding.
11545688 Identical mutations in NOG can cause either tarsal/carpal coalition syndrome or proximal symphalangism.
10780858 2000 Essential requirement of BMPs-2/4 for both osteoblast and osteoclast formation in murine bone marrow cultures from adult mice: antagonism by noggin.
10657699 2000 Noggin is a negative regulator of neuronal differentiation in developing neocortex.
10087923 1999 TGF beta inhibitors. New and unexpected requirements in vertebrate development.
10080184 1999 Heterozygous mutations in the gene encoding noggin affect human joint morphogenesis.
9634519 1998 Localization of a multiple synostoses-syndrome disease gene to chromosome 17q21-22.
9603738 1998 Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton.
9585504 1998 Noggin-mediated antagonism of BMP signaling is required for growth and patterning of the neural tube and somite.
8752214 1996 The Spemann organizer signal noggin binds and inactivates bone morphogenetic protein 4.
8582276 1995 Fibroblast growth factor is a direct neural inducer, which combined with noggin generates anterior-posterior neural pattern.
7666191 1995 Identification of mammalian noggin and its expression in the adult nervous system.
7557985 1995 Localization of the gene (SYM1) for proximal symphalangism to human chromosome 17q21-q22.