Property Summary

NCBI Gene PubMed Count 94
PubMed Score 981.71
PubTator Score 215.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Holoprosencephaly 56 6.866 3.4
Heterotaxy, Visceral, 5, Autosomal 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Right atrial isomerism 29 0.0 5.0
Disease Target Count Z-score Confidence
Visceral heterotaxy 14 0.0 4.0

Expression

 GO Component (1)

Protein-protein Interaction (2)

Gene RIF (89)

AA Sequence

MHAHCLPFLLHAWWALLQAGAATVATALLRTRGQPSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDG      1 - 70
QNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVT     71 - 140
LSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRVAGECWPRPPTPPATNVLLMLYSNLSQEQRQLGGS    141 - 210
TLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGEC    211 - 280
PNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL       281 - 347
//

Text Mined References (95)

PMID Year Title