Property Summary

NCBI Gene PubMed Count 789
PubMed Score 1371.92
PubTator Score 1555.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ulcerative colitis 1.200 4.2e-04
malignant mesothelioma -1.400 3.2e-06
esophageal adenocarcinoma -1.100 3.6e-02
psoriasis 1.900 7.6e-223
osteosarcoma -2.880 7.7e-05
Atopic dermatitis 1.300 1.2e-04
interstitial cystitis 1.200 3.1e-03
posterior fossa group A ependymoma 1.300 2.7e-04
ovarian cancer 1.200 9.5e-06

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
1566 confirmatory 1839 / 0 / 290647 uHTS luminescence assay for the identification of compounds that inhibit NOD2
1579 summary 0 / 0 / 1 Summary assay for the identification of compounds that inhibit NOD2
2001 confirmatory 263 / 0 / 282 uHTS luminescence assay for the identification of compounds that inhibit NOD2 in MDP treated cells
2334 confirmatory 46 / 0 / 92 SAR analysis of compounds that inhibit NOD2 revised
2475 confirmatory 14 / 0 / 6 SAR analysis of compounds that inhibit NOD2 - Set 2
2799 confirmatory 10 / 0 / 30 SAR analysis of compounds that inhibit NOD2 - Set 3
624267 screening 1387 / 0 / 362744 Fluorescence-based cell-based primary high throughput screening assay to identify inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
624283 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
624370 screening 859 / 0 / 363 Fluorescence-based cell-based high throughput confirmation assay for inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
651553 confirmatory 193 / 0 / 39 Fluorescence-based cell-based high throughput dose response assay for inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
More...

Gene RIF (924)

PMID Text
27050483 CaSR-induced constitutive macropinocytosis facilitates the sentinel function of macrophages, promoting the efficient delivery of ligands to cytosolic pattern-recognition receptors.
27007849 NOD1 and NOD2, two members of the NOD-like receptor family of pattern recognition receptors, are important mediators of ER-stress-induced inflammation in mouse and human cells
26752466 Increased Expression of NOD2 is associated with Inflammatory Bowel Disease.
26752461 NOD2 Loss-of-Function Mutations are associated with Necrotizing Enterocolitis and Focal Intestinal Perforation.
26606664 This is the first description of gonosomal NOD2 mosaicism as the cause of intrafamilial recurrence of Blau syndrome.
26562405 The INCA trial (impact of NOD2 genotype-guided antibiotic prevention on survival in patients with liver cirrhosis and ascites): precision medicine for patients with liver cirrhosis and ascites
26517420 Blau syndrome has been strongly associated with mutations in the NOD2 gene. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201507-1344LE#.VrgfNNL2byA
26316104 Significant associations were found between Crohn's disease (CD) and minor NOD2 variants, as well as TLR4 299Gly, TNF-alpha G-308A, IL-6 G-174C and IL-1RN VNTR A2 variants, while ulcerative colitis (UC) was associated only with IL-1RN VNTR A2 variants.
26238283 the rs2066847 variant of the NOD2/CARD15 gene is not associated with lung cancer risk in the Turkish population
26235265 The genetic variants in the NOD2 is closely associated with leprosy is Chinese population.
26167078 NOD2 gene is significantly associated with a specific clinical sub-phenotype in Crohn's disease.
26147989 data demonstrate that in Crohn's disease patients the IVS4+10 A>C NOD2 variant is strongly associated with the development of perianal fistulas
26116899 HIV-1 Vpr upregulates the gene expression of NOD2 in human monocyte-derived dendritic cells
26070941 NOD2 genotype is associated with NOD2-associated autoinflammatory disease (NAID), which is a genetically complex multisystem disorder.
26042516 The risk for Crohn's disease is increased in patients with NOD2 mutations (Poland) and especially in the presence of homozygous NOD2 mutations (Poland and Bosnia).
26019273 After chronic NOD2 stimulation, Twist1 and Twist2 coordinate the regulation of both transcriptional activators and repressors, thereby mediating optimal cytokine down-regulation.
25988661 data describe donor NOD2 SNP13 as a significant risk factor for the development of septic shock after allogeneic stem cell transplantation
25933107 NOD1 rs2709800, NOD2 rs718226, rs2111235, rs7205423 and interaction between rs718226 and H. pylori infection may be related to risk of gastric lesions.
25922834 The expression of NOD2 mRNA and protein was significantly induced in cholesteatoma compared to the external auditory canal skin, mainly located in the epithelial layer of cholesteatoma.
25910289 These findings suggest that NOD2/CARD15 influences disease behaviour but not susceptibility to crohn's disease in Moroccan IBD patients.
25840495 The higher NOD1 and NOD2 were observed in villi from patients who experienced recurrent spontaneous abortion compared with those who experienced a normal pregnancy.
25825396 Human platelets express NOD2. Plasma from septic patients also potentiates platelet aggregation induced by thrombin or collagen NOD2 dependently.
25801769 NF-kappaB activation is required for NOD2-dependent expression of NOS2 in human macrophages.
25722298 Polymorphisms in TLR1 (R80T), NOD2 (L1007fsX1), and MYD88 (-938C>A) are associated with predisposition to development of chronic Q fever.
25674246 The appropriate expression of NOD2 in normal decidual stromal cells suggests that this protein may be required to sustain normal pregnancy.
25670499 NOD2 can down-regulate the expression of human enteric antimicrobial peptides during differentiation of the Paneth cell lineage.
25664710 The NOD2 single nucleotide polymorphism rs2076756 was associated with younger age at Crohn's disease diagnosis.
25649363 The greatest risk for Crohn's disease represent polymorphisms affecting the CARD15 gene encoding nucleotide-binding oligomerization domain 2 (NOD2).
25549945 Complex interactions exist between TLR2 and NOD2 in human corneal epithelial cells inflammatory response against A. fumigatus infection.
25367361 Association between leprosy and tag SNPs at NOD2 (rs8057431) and CCDC122-LACC1 (rs4942254).
25365249 the NOD2 variant p.Leu1007fsX1008 (rs2066847), in particular in homozygous form, is a much stronger marker for a severe clinical phenotype than the FOXO3A rs12212067 SNP for a mild disease course on an individual patient level.
25335775 genetic polymorphism does not affect TNF-alpha secretion upon Mycobacterium avium paratuberculosis stimulation but influences TNF-alpha levels following stimulation with Listeria monocytogenes
25326182 Aberrant expression of NOD2 in granulocytes contributes to impaired innate immunity predisposing to allergic asthma.
25259511 we have observed that NOD2 and IL23R genomic regions of European descent contribute to CD in Puerto Rico.
25248089 Our meta-analysis suggests that pairs NOD2 SNPs, not patient NOD2 SNPs, may be associated with Grade III-IV aGVHD risk, especially in the Caucasian population.
25183734 Experiments using peripheral blood mononuclear cells (PBMCs) from Crohn's disease patients with nonfunctional NOD2 showed that MMP-9 induction by Streptococcus pneumoniae and MDP is NOD2 dependent.
25171511 NOD2 mutations are associated with inflammatory bowel disease.
25170077 USP8, and the endosomal sorting protein, VPS28, are the negative regulators of NOD2-induced IL-8 secretion.
25148897 Studied the association between NOD2 rs3135500 polymorphism located at 3' untranslated region of the gene and risk of sporadic colorectal cancer.
25093298 Polymorphisms in NOD2 can cause the inflammatory disorders Blau Syndrome and early onset sarcoidosis through receptor hyperactivation.
25053139 Genetic association between a 'standing' variant of NOD2 and bipolar disorder
25048429 we found that CARD15 was not significantly associated with the occurrence of Crohn's Disease in Chinese population.
25042478 this study suggests that NOD2 contributes to the expansion of the lipid-rich necrotic core and promotes vascular inflammation in atherosclerosis.
25024364 This work reveals a role of Aggregatibacter actinomycetemcomitans outer membrane vesicles as a trigger of innate immunity via carriage of NOD1- and NOD2-active pathogen-associated molecular patterns (PAMPs).
24960071 interaction between NOD2 and CARD9
24932916 NOD2 expression in decidual stromal cells plays an important role in protecting the embryo and preventing infection in the maternal-fetal interface.
24901824 A family was heterozygous for risk variants of the genes encoding NOD2 and TLR5 and homozygous carriers of PTPN2 risk alleles in Crohn disase.
24832447 Endosomal membranes are sites of NOD1/NOD2-dependent signal transduction.
24803813 Patients carrying NOD2/CARD15 mutations follow a rapid and more aggressive form of Crohn's disease showing a trend for multiple surgical interventions and significantly shorter time to early surgery.
24790089 restoring the stability of the NOD2 Crohn mutants is sufficient for rescuing the ability of these mutations to signal the presence of a bacterial cell wall ligand
24782627 NOD2 P268S polymorphism may be associated with Crohn's disease susceptibility in the Zhuang population in the Guangxi Zhuang Autonomous Region, China.
24781050 Mo-DCs from CD patients heterozygous for NOD2 mutations had a response similar to those from patients without NOD2 mutations.
24722226 Polymorphisms in the identified chitin receptors, NOD2 and TLR9, predispose individuals to inflammatory conditions and dysregulated expression of chitinases and chitinase-like binding proteins
24719038 3020insC NOD2/CARD15 polymorphism is associated with Crohn's disease and response to treatment in colorectal cancer.
24695226 Endosomes are specialized platforms for bacterial sensing and NOD2 signalling
24682985 None of the NOD2/CARD15 variants was statistically associated to CRC susceptibility in our Malaysian population.
24679666 In this Algerian cohort, NOD2/CARD15 was associated with CD's outcomes and linked to a particular clinical phenotype
24671169 NOD2 plays a significant role in NOD2 plays a significant role in HCMV replication.
24670424 NOD2 downregulates colonic inflammation by IRF4-mediated inhibition of K63-linked polyubiquitination of RICK and TRAF6.
24656308 our analyses of genotype/phenotype correlation showed that patients heterozygous for the NOD2/CARD15 rs2066847(1007 fs) allele had more frequent ileal involvement than children showing the wild-type variant.
24651958 Our study suggests that even though NOD2 mutations do not confer an increased risk of ulcerative colitis in the Portuguese population, these genetic variants are associated with a more aggressive course of the disease.
24627602 Monocytes of Crohn's disease patients show enhanced phagocytosis associated with the presence of ATG16L1 and NOD2 variants.
24597572 Mutations in the NOD2 gene may put patients both at an increased risk for acquiring M. tuberculosis infections as well as at an increased risk of intestinal failure after extensive intestinal resection.
24586700 NOD2 polymorphisms are associated with cancer risk.
24444388 Monocyte expression and function of NOD1 and NOD2 in very preterm infants are intact and comparable/equivalent to term infants and adults.
24393249 Our study indicates that wild type NOD2 confers a survival benefit to non-alcoholic patients who receive a liver transplant.
24391456 present meta-analysis suggested that NOD2 Arg702Trp polymorphism was likely to be a protective factor for TB. However, the Arg587Arg and Gly908Arg polymorphisms might not be the genetic risk factors for TB susceptibility
24366254 The Nod1/2-Rip2 axis was critical to induce optimal cytokine and chemokine responses to A. baumannii infection.
24360029 Leu3020insC mutation was found in in 3/35 (8.5%) asymptomatic relatives of Crohn's disease patients. Those relatives had no pathologic evidence of disease.
24345423 SNP8 NOD2 positivity in donors or recipients makes patients more prone to Herpes viruses reactivation and bacteremia but not to sepsis. Septic complications were associated with SNP13 NOD2 polymorphism.
24298015 our data comprise the most comprehensive investigation to date on NOD2 as a contributor to host defense in melioidosis.
24297055 To our knowledge, this is the first report demonstrating that miRNAs regulate NOD2 and its signaling pathway.
24295830 bacterial infection-mediated activation of NOD1,2, together with IL-32gamma, can synergize the activation of eosinophils interacting with bronchial epithelial cells.
24099766 Overexpression of nucleotide-binding oligomerization domain-2 (NOD2) resulted to be essential in the enhancement of IL-8 induced by S. aureus.
24098051 These findings demonstrate that ribosomal stress-induced ATF3 is a critical regulator in the convergent pathways between EGR-1 and NF-kappaB, which contributes to the suppression of Nod2-activated proinflammatory gene expression.
24076061 The number of Crohn's disease associated risk alleles of NOD2 (R702W, G908R, L1007fsXinsC) correlates to the proportion of abnormal paneth cells.
24054330 study has shown that NOD2 is critical for induction of miR-29 in DCs and defined a number of new miR-29 regulated genes in these cells, including those affecting IL-23 expression
24047397 The CARD15 3020insC variant is a risk factor for intestinal gastric cancer in Portugal.
24018334 NOD1 and NOD2 mRNA expression were significantly up-regulated in monocytes from patients with type 2 diabetes.
24015287 LRRK2 and RIPK2 variants in the NOD 2-mediated signaling pathway are associated with susceptibility to Mycobacterium leprae in Indian populations.
23991106 data demonstrate that PTPN22 controls NOD2 signaling, and loss of PTPN22 renders monocytes more reactive towards bacterial products, what might explain the association of PTPN22 variants with IBD pathogenesis
23977330 The mutated NOD2 R702W genotype in the recipient is independently associated with an increased risk of bacterial infections after liver transplantation.
23901396 NOD1 and NOD2 receptors appear to recognize both invasive and non-invasive forms of the bacteria. (Review)
23892590 Our study provides evidence that Staphylococcus aureus activates NOD2 in keratinocytes, resulting in an increased expression of IL-17C, a mechanism that may be dysregulated in atopic dermatitis.
23888881 NOD2 polymorphisms are discovered in patients with betalactam hypersensitivity in two populations from Italy and Spain.
23872065 Taken together, these results indicate that miR-122 and its target gene NOD2 may play an important role in the injury of intestinal epithelial cells induced by LPS.
23868940 Results suggest that atherosclerosis may involve enhanced NOD2-mediated innate immunity.
23850724 our results present initial evidence that AI of the NOD2 and ATG16L1 genes exists in populations of human DCs
23824692 we conclude that genetic variation in NOD2 associates with noncardia gastric cancer while variation in CD14 is associated with cardia gastric cancer.
23818254 analysis of mutations in the XIAP BIR2 domain impair NOD2-dependent immune signalling
23740944 NOD2 activation increases in laboring fetal membranes and myometrium and with bacterial infection
23712977 Activation of NOD1 and NOD2 both significantly suppressed adipocyte differentiation of human adipose-derived adult stem cells, demonstrating the species specific effects of NOD activation.
23711367 A novel function for Ankrd17 in Nod1 and Nod2 mediated anti-bacterial innate immune pathways.
23709157 Mutant NOD2 plays a possible role in the immunological response in inflammatory bowel disease pathogenesis
23651603 Our results suggested that the P268S variant in NOD2 might be a risk factor for susceptibility to sporadic Parkinson's disease in Chinese populations.
23615072 Data indicate that HEATR3 plays a positive role in NOD2-mediated NF-kappaB signaling.
23594678 NOD2 is one of the critical components of a signal transduction pathway that links renal injury to inflammation and podocyte insulin resistance in diabetic nephropathy.
23562557 We present direct evidence that NOD2 mutations are associated with the development of Short bowel syndrome and intestinal failure after intestinal resection.
23558906 The association of Arg702Trp, Gly908Arg, or Leu1007fsinsC with complications in acute myeloid leukemia was studied. Streptococcal bacteremia correlated with missense or frameshift mutation. Mucositis & enteritis were rare in those lacking mutations.
23493074 NOD2 polymorphism was not significantly associated with postsurgical recurrence in Crohn's disease.
23488593 Hidradenitis suppurativa is probably not associated with CARD15/NOD2 mutations.
23437331 p62/SQSTM1 enhances NOD2-mediated signaling and cytokine production through stabilizing NOD2 oligomerization.
23409731 frequently encountered variants are not important for Turkish patients with ankylosing spondylitis
23322906 Data suggest a role for NOD2 and NF-kappaB pathways in the pathogenesis of Crohn's disease.
23300079 Data suggest that ubiquitin (Ub) binding provides a negative feedback loop upon NOD1 and NOD2 (nucleotide-binding oligomerization domain-containing proteins)-dependent activation of receptor-interacting protein kinase 2 (RIP2).
23287275 Chronic Nod2 stimulation of human monocytederived macrophages enhances bacterial killing,despite downregulating cytokine secretion upon restimulation through pattern-recognition receptor and live bacteria.
23173613 Report frequency of NOD2 SNPs among patients with intestinal failure.
23121969 The cooperation of TLR5 and Nod2 in intestinal epithelial cells regulates inflammatory response to Salmonella infection.
23109427 a molecular mechanism for cIAP1's regulation in the NOD2 signaling pathway
23102769 The characteristic clinical phenotype, notably dermatitis, coupled with certain NOD2 variants constitutes a new autoinflammatory disease entity
23100559 NOD2 influences the production of IL-17A by CD4(+) T lymphocytes and might contribute to the development of ocular toxoplasmosis.
23085276 Four NOD2 polymorphisms were identified for the first time in the Indian population. Of 8 NOD2 polymorphisms, none were associated with CD but two were weakly associated with UC. NOD2 polymorphisms do not play a major role in CD genesis in India.
23019338 Nod2 protein stability is a key factor in determining responsiveness to MDP stimulation. This indicates that TLRs and NLRs induce a tolerant state through distinct molecular mechanisms that protect the host from septic shock.
22998942 we demonstrate that NOD2, but not NOD1, is important in the pattern recognition of B. fragilis
22997500 NOD2 activation can promote vascular smooth muscle cell to secrete inflammatory cytokines.
22879519 The NOD2insC polymorphism is associated with worse outcome following ileal pouch-anal anastomosis for ulcerative colitis.
22829933 Data conclude that TRIM27 negatively regulates NOD2-mediated signaling by degradation of NOD2 and suggest that TRIM27 could be a new target for therapeutic intervention in NOD2-associated diseases.
22815893 inositol phosphatase SHIP-1 inhibits NOD2-induced NF-kappaB activation by disturbing the interaction of XIAP with RIP2
22807259 Our findings show no association between NOD2 and Parkinson dis in Germany
22795647 cooperative activation of DCs with NOD1 and NOD2 agonists and TLR7/8 ligands results in a synergistic release of pro-inflammatory mediators which promote the activation of IL-17-producing T cells.
22739221 Perianal disease and the NOD2 genotype were the only independent factors associated with the need for surgery in this group of patients with Crohn's disease
22730064 Stimulation with RSV induced IFN-beta expression, which resulted in an increased expression of the viral receptors TLR3 and RIG-I, as well as an increased NOD2 expression.
22719818 IBD phenotype, Clostridia difficile and NOD2 genotype were selected as associated (FDR </= 0.05) with shifts in overall microbial composition. IBD phenotype
22700971 JNKBP1 and NOD2 are co-expressed in the human intestinal epithelium and in immune cells recruited in the lamina propria, which suggests that JNKBP1 contributes to maintain NOD2-mediated intestinal immune homeostasis.
22684479 Vimentin is an important regulator of NOD2 function and a potential novel therapeutic target in the treatment of Crohn disease (CD).
22665475 RIP2 tyrosine kinase activity is not only required for NOD2-dependent autophagy but plays a dual role in this process.
22605977 This genetic study provides evidence that the three major CARD15/NOD2 variant alleles and the CD14 -159C/T polymorphism are associated with Crohn's disease (CD) susceptibility in the Saudi population.
22571967 this study confirms the association between CARD15 variants and both Crohn's Disease incidence and specific phenotype (aggressive and complicated disease that develops in young age), in particular for complex genotypes.
22563200 Genetic polymorphisms in NOD1 and NOD2 may interact with H. pylori infection and may play important roles in promoting the development of gastric cancer in the Chinese population.
22549783 NOD2 binds and hydrolyzes ATP and the purified recombinant protein is able to bind directly to muramyl dipeptide and can associate with known NOD2-interacting proteins in vitro.
22509093 The R334W mutation in NOD2/CARD15 caused Blau syndrome in a Chinese pedigree.
22504414 NOD2 (rs9302752) and RIPK2 (rs42490) were found to be associated with development of lymph node metastasis.
22502597 This study is the first to demonstrate that the Arg587Arg SNP in NOD2 is a new possible risk factor for tuberculosis in the Chinese Han population, but not in the Uyghur and Kazak populations.
22464675 Granulomas from patients with BS and granulomas from patients with NOD2-associated CD show distinct morphologic features and cytokine expression patterns.
22426692 The study indicates that IL23R-rs11805303 and PTPN2-rs2542151 might contribute to the development of ulcerative colitis and NOD2-P268S might be involved in the etiology of Crohn's disease in the Chinese Han population.
22416979 Upon analysis of individual polymorphisms, it was observed a significant departure from multiplicativity only between the 1007fs risk allele and history of ever having smoked and history of smoking at time of Crohn's disease diagnosis.
22397822 cells, that peptidoglycan specifically stimulates PD-L1 expression and, using Crohn's disease derived mutants, that this occurs through both NOD2 dependent and NOD2 independent mechanisms
22346247 role of ATG16L, NOD2 and IL23R in Crohn's disease [review]
22319155 Crohn disease (CD)-risk alleles, which destabilize and disrupt the NOD2 protein, have been maintained by natural selection on standing variation because the deleterious haplotype of NOD2 is advantageous in diploid individuals due to heterozygote advantage
22289211 NOD 2 variants play a minimal role in susceptibility/resistance to tuberculosis and leprosy.
22286692 The first identified susceptibility gene for Crohn's disease, NOD2, acts as a sensor for the bacterial-wall peptidoglycan fragment muramyl dipeptide (MDP) and activates the transcription factor nuclear factor-kappaB (NF-kappaB).
22275320 NOD2 3020insC Variant is associated with increased anti-Saccharomyces cerevisiae antibodies in Crohn's disease.
22266421 No evidence association of NOD2 gene with Crohn's disease in the Moroccan population.
22244368 NOD2/CARD15 mutations are not associated with an increased susceptibility to develop familial Mediterranean fever.
22218461 NOD1 and NOD2 are functionally expressed in human periodontal ligament cells and can trigger innate immune responses.
22212192 Data suggest that single nucleotide polymorphism (SNP) rs7194886 in the NOD2 gene, which were discovered in the genome-wide association study (GWAS) of leprosy, might also be associated with the pulmonary tuberculosis in the Chinese population.
22147245 therapy of CD patients with NOD2 mutation carrier status was steroid refractory but could be treated well with immunosuppressants
22139875 The results of the present study show that the CARD15/NOD2 mutations in Iranian patients with pediatric onset CD are not responsible for the pathogenesis of disease.
21978001 Data show that eosinophils expressed NOD1 and NOD2 mRNA and protein, low levels of RIG-I and MDA-5, and NLRP3 was completely absent.
21943069 The NOD2 rs1077861 SNP may influence the development and progression of COPD in Japanese subjects.
21914217 Patients with autoinflammatory disease had negative tests for autoantibodies but carried the NOD2 gene mutation IVS8+158 with some having concurrent R702W mutation.
21887730 GEF-H1 mediated the activation of Rip2 during signaling by NOD2, but not in the presence of the 3020insC variant of NOD2 associated with Crohn's disease. GEF-H1 functioned downstream of NOD2 as part of Rip2-containing signaling complexes.
21799103 we found evidence that NOD2/CARD15 polymorphisms influence outcome after allogeneic stem cell transplantation
21768114 mechanistic and functional insights into TLR2- and NOD receptor-mediated regulation of dendritic cell functions and unravels NOTCH1-PI3K as a signaling cohort for TLR2 and NOD receptors
21745515 NOD1/CARD4 and NOD2/CARD15 gene polymorphisms may be associated with altered risk for a large variety of cancers in humans. (Review)
21745302 NOD2 variants increase the risk for culture-positive spontaneous bacterial peritonitis and bacterascites in cirrhosis and may affect survival.
21744420 Systemic inflammatory reaction was associated with bacterial DNA translocation in a concentration-dependent manner and a wildtype NOD2/CARD15 genotype was required for an adequate antimicrobial peptide response against these bacterial challenges.
21739538 NOD2 and NOD1 variants displayed antagonist effects on the risk of Crohn disease and anti-saccharomyces cerevisiae antibody level.
21734790 Data show that Crohn's disease-associated polymorphisms affected the elimination of mycobacterium avium subspecies paratuberculosis from monocytes (NOD2), or expression of certain cytokines (ATG16L1), implying independent roles in CD pathogenesis.
21734346 Mutations in NOD2 may be linked with inflammatory bowel diseases.
21730793 This study demonstrates that both NOD2 risk alleles and smoking were associated with an increased risk of developing ileal Crohn disease vs isolated colonic disease.
21716313 Our results support association of the TLR10 gene with CD susceptibility. The effect of TLR10 would be independent of NOD2, suggesting different signaling pathways for both genes.
21699783 Epistatic and biological interactions between TLE1 and NOD2 are involved in inflammatory bowel disease pathogenesis.
21690088 RIG-I and NOD2 form a direct interaction at actin-enriched sites within cells and suggest that this interaction may impact RIG-I- and NOD2-dependent innate immune signaling.
21665963 Organic-dust extract-induced NOD2 expression is directly dependent on NF-kappaB signaling, and NOD2 is a negative regulator of complex, organic dust-induced inflammatory cytokine/chemokine production in mononuclear phagocytes.
21659536 Stimulation of yeast telomerase activity by the ever shorter telomere 3 (Est3) subunit is dependent on direct interaction with the catalytic protein Est2.
21625457 results indicate that the NOD2 rs5743291 polymorphism influences T helper (Th) cell 2- and Th17 cell responses in MNC from MS patients
21596301 Genetic testing confirmed the diagnosis of Blau syndrome. Despite immunosuppression, at almost 7 years of age, she continues to have persistent panuveitis with vision of 20/20.
21573891 in the Japanese population, unlike the Caucasian, NOD2 is not a major contributor to susceptibility to severe acute GVHD.
21565239 In a Caucasian population NOD2/CARD15 polymorphisms influence the development of clinically evident and angiographically documented coronary artery disease.
21460759 Our findings suggest that common polymorphisms in the NOD2/CARD15 gene may play a major role in susceptibility to sepsis and the outcome of sepsis in children.
21448648 An association between NOD2/ CARD15 polymorphisms and psoriasis/psoraitic arthritis was not found. No obvious publication bias was shown in the results.[meta-analysis]
21410503 these results indicate that in addition to the T cell receptor and Toll-like receptors, circulating human cd T cells express NOD2 as a third class of pattern recognition receptor for sensing bacterial products.
21391291 Single nucleotide polymorphisms in NOD2 is associated with Crohn's disease.
21388357 there is no association between the CARD15 gene and the development or a special phenotype of sarcoidosis in our cohort
21385537 No support found for an association of CARD15 muations and Behcet's disease in Israel for Arabs and Jews.
21343918 Presence of two NOD2 mutations had 98% specificity for complicated Crohn's disease.
21342182 NOD1, NOD2 and RIG-1/MDA-5 have a role in T-cell activation.
21337670 NOD2 polymorphisms linked to a specific disease endophenotype of Crohn's disease.
21335489 A cellular transcriptomal signature program elicited by muramyl dipeptide-dependent activation of NOD2 dissects a complex myelomonocytic cell regulatory network and sheds new light on the role of NOD2 variants associated with Crohn's disease.
21310790 two nucleotide-binding domain and leucine-rich repeats employ different modes of activation and propose distinct models for activation of NOD1 and NOD2.
21274544 The aim of this study was to assess all exonic sequences of the NOD2 gene in Iranian Crohn's disease patients and healthy controls.
21263023 study shows that non-O1 non-O139 serogroups outer membrane vesicles elicit immune responses mediated by NOD1 and NOD2 in mammalian host cells
21241317 NOD1, NOD2, and NALP3 mRNA and protein were seen in all tissue specimens, but were higher in nasal polyps than in normal nasal mucosa
21218092 polymorphisms of NOD2/CARD15 gene Arg702Trp, Gly908Arg and Leu1007fsinsC were genotyped and compared between IBD patients and controls; common variants in NOD2/CARD15 gene are not associated with IBD in China's Zhejiang population
21215810 Data indicate that mutations in the NOD2/CARD15 gene are not a risk factor for clinical outcome in nonmyeloablative allogeneic SCT.
21209938 NOD2 variants rs2066843 and rs2076756 are novel and common Crohn's disease susceptibility gene variants
21206965 IL23R, NOD2/CARD15, ATG16L1 and PHOX2B polymorphisms in a group of patients with Crohn's disease and correlation with sub-phenotypes.
21155887 Common variants in NOD2 and IL23R are not associated with inflammatory bowel disease in Indians.
21123652 RIP2 undergoes autophosphorylation on Tyr 474 and this event is necessary for effective NOD2 signaling
21097508 A novel motif in the Crohn's disease susceptibility protein, NOD2, allows TRAF4 to down-regulate innate immune responses.
21042538 findings suggest that NOD1 and NOD2 as well as TLRs are involved in regulating the differentiation of MSCs
21040358 results provide evidence that NOD2 is an important intracellular receptor in regulating the host response to Mycobacterium tuberculosis and BCG infection in human macrophages
21040192 No association with the three common NOD2 mutations in Korean pediatric patients with CD and UC. There is great genetic heterogeneity between Asian and Western people, so further studies are warranted to identify genetic susceptibility of Korean children.
21040192 Observational study of gene-disease association. (HuGE Navigator)
21039068 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20959815 In short gut syndrome in children NOD2 gene polymorphism associates with the need of combined liver and intestine transplantation.
20959815 Observational study of gene-disease association. (HuGE Navigator)
20940596 Asymptomatic IPAA patients have a low incidence of NOD2 mutations not significantly different from patients with mild pouchitis or healthy controls. Patients with severe pouchitis had the highest incidence of NOD2 mutations.
20940596 Observational study of gene-disease association. (HuGE Navigator)
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20875485 polymorphisms in ATG16L1 and NOD2, we may find that some of these risk factors affect the same pathway. What if this epistatic relationship between NOD2 and ATG16L1 is representative of disease risk factors
20865702 Observational study of gene-disease association. (HuGE Navigator)
20854823 These results further contribute to understanding of the mechanisms through which Nod2, a protein critical to intestinal homeostasis, down-regulates cytokine responses.
20850627 NOD2 variants causatively associated with Crohns disease do not predispose to the development of Hirshsprung-associated enterocolitis.
20850627 Observational study of gene-disease association. (HuGE Navigator)
20844241 Functional NLRs are expressed in human B cells. NOD1 and NOD2 have the ability to augment B cell receptor-induced activation independently of physical T cell help.
20839241 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20713205 Observational study of gene-disease association. (HuGE Navigator)
20676658 The CARD15 R702W variant might be a predisposing factor to sporadic CRC in Portugal, particularly in patients under 60-years old and in female patients
20676658 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20646321 Observational study of gene-disease association. (HuGE Navigator)
20646002 Results indicate that NOD2 polymorphisms do not confer susceptibility to CVIDs.
20646002 Observational study of gene-disease association. (HuGE Navigator)
20637199 ATG16L1 and NOD2 are components of an autophagy-mediated antibacterial pathway that is altered in a cell- and function-specific manner by CD-associated mutations.
20632099 In Crohn's disease, CARD15 mutations are not associated with risk of developing perianal fistulas or with time of their outbreak. Nevertheless, patients with perianal fistulas and CARD15 mutations showed worse response to antibiotics.
20632099 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622911 Acute GVHD grade III-IV was higher in acute myeloid leukemia patients following hematopoietic stem cell transplantation with NOD2 gene variants (28 vs 12.8%
20622911 Observational study of gene-disease association. (HuGE Navigator)
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20595247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20583427 Lf1007fs, R702W and G908R mutations of CARD15 are not responsible for the pathogenesis of Crohn's disease in Iranians.
20583427 Observational study of gene-disease association. (HuGE Navigator)
20565245 Blau syndrome should be considered in the differential diagnosis of childhood uveitis and the genetic analysis of the CARD15/NOD2 gene is helpful in the diagnosis.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20541026 NOD2 SNPs did not predict aGVHD, but IL-23R(1142A>G) and BPI(A645G) SNPs appeared to be promising markers in this regard.
20541026 Observational study of gene-disease association. (HuGE Navigator)
20537165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20525885 Gain- and loss-of-function experiments show that Kruppel-like factor 2 (KLR2) expression depends on TLR2 stimulation, as well as on NOD2 stimulation.
20524760 NOD2/CARD15 mutations associated with Crohn's disease have demonstrated heterogeneity across ethnicities and populations throughout the world, with regional variations across Europe and Spain
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485703 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
20483763 we observed a clear deficiency in the quantity of FOXP3+ lymphocytes in patients with disease-associated polymorphisms in the pathogen recognition receptor gene NOD2
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20441518 These data This raise the intriguing possibility that recognition of Borrelia spirochetes is exerted by TLR2 in combination with NOD2 and that both receptors are necessary for an effective induction of cytokines by Borrelia species.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20436512 The results show that the NF-kappaB binding site is critical for regulation of the NOD2 gene
20428899 Fistulizing Crohn's disease is strongly associated with concomitant intestinal stenosis, particularly in homozygous carriers of NOD2 mutations
20428899 Observational study of gene-disease association. (HuGE Navigator)
20412372 The NOD2/CARD15 Arg702Trp, Gly908Arg and Leu1007fsinsC polymorphisms were not associated with increased risk of cardiovascular disease or cancer in the Danish general population.
20412372 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20387682 Major polymorphic variants of the NOD2/CARD15 gene predisposing to CD on the risk, course, and other features of CD.
20385562 Data show that CARD8 represents a novel molecular switch involved in the endogenous regulation of NOD2-dependent inflammatory processes in epithelial cells.
20384614 Nod1, Nod2, and Nalp3 receptors were found to be present in the human nose. The expression of Nod1 and Nalp3 were down-regulated during pollen season among patients with allergic rhinitis
20380008 Polymorphism 3020insC in NOD2/CARD15 occurs statistically significantly more often in patients with childhood-onset Crohn's disease (CD) than in patients with adult-onset CD.
20380008 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373538 data do not support the role of CARD15 in oral symptoms and periodontal lesions in patients with Crohn's disease
20373538 Observational study of gene-disease association. (HuGE Navigator)
20371648 Observational study of gene-disease association. (HuGE Navigator)
20362271 Observational study of gene-disease association. (HuGE Navigator)
20350193 SNPs associated with susceptibility to leprosy and the development of leprosy reactive states
20350193 Observational study of gene-disease association. (HuGE Navigator)
20346235 Common NOD2 gene variants are not associated with psoriatic arthritis, but might increase the risk of joint replacement surgery; this autoinflammatory-associated gene could act as a phenotypic modifier gene by increasing the risk of joint destruction
20346235 Observational study of gene-disease association. (HuGE Navigator)
20332463 Mutations in NOD2 gene is associated with gastric carcinogenesis.
20332463 Observational study of gene-disease association. (HuGE Navigator)
20298285 Danish sarcoidosis patients have frequent variations in CARD15 exon 4, but do not present any mutation associated with Blau syndrome. The variations found had no influence on the course of disease.
20298285 Observational study of gene-disease association. (HuGE Navigator)
20232407 This study for the first time demonstrates that translocation of luminal bacteria and/or bacterial products into the intestinal mucosa is increased in patients carrying NOD2 variants, leading to higher activation of proinflammatory signaling cascades.
20232407 Observational study of gene-disease association. (HuGE Navigator)
20230816 polymorphism 802C>T is associated with changes in gastric mucosa and plays a significant role in the initiation and the progression of carcinogenesis. The number of observed mutations in gastric mucosa correlated with severity of disease.
20230816 Observational study of gene-disease association. (HuGE Navigator)
20182871 Observational study of gene-disease association. (HuGE Navigator)
20177049 Insufficient evidence for association of NOD2/CARD15 or other inflammatory bowel disease-associated markers on GVHD incidence or other adverse outcomes in T-replete, unrelated donor transplantation.
20177049 Observational study of gene-disease association. (HuGE Navigator)
20155851 NOD2 single nucleotide polymorphisms are associated with ileal Crohn's disease.
20155851 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20124104 Data show that Nod1 and Nod2 were expressed highly in both human and mouse RTE cells.
20110711 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20087966 Nucleotide-binding oligomerization domain containing 2 (NOD2) variants are genetic risk factors for death and spontaneous bacterial peritonitis in liver cirrhosis.
20087966 Observational study of gene-disease association. (HuGE Navigator)
20082483 There is a strong association between Crohn's disease susceptibility and the Leu1007insC variant in NOD2 in the Lithuanian study population.
20082483 Observational study of gene-disease association. (HuGE Navigator)
20079790 gene polymorphism is not associated with inflammatory bowel diseases in Hungarian cohort
20079790 Observational study of gene-disease association. (HuGE Navigator)
20066736 Combined risk of susceptibility pairs was higher in Crohn's disease patients carrying two different variants than individuals with just one polymorphism. The highest odds ratio was found for IL23R genotype in combination with positive CARD15 status.
20066736 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20047977 Meta-analysis of gene-disease association. (HuGE Navigator)
20032092 Observational study of gene-disease association. (HuGE Navigator)
20027650 NOD2 allelic variants were primarily associated with fibrostenosis and secondarily with small bowel disease, and were inversely associated with ulcerative colitis-like disease.
20027650 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20024904 Variants at the NOD gene at 3p21 locus influence susceptibility and phenotype both in adults and early-onset patients with inflammatory bowel disease.(
20024904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20018961 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20002790 expression of NOD1, NOD2 and NLRP3 messenger RNA was determined in neutrophils
19966812 activation by muramyldipeptide induces autophagy in dendritic cells; variants in Crohn's disease are defective in autophagy induction
19948723 strong molecular links between vitamin D deficiency and the genetics of Crohn disease, a chronic incurable inflammatory bowel condition, as Crohn's pathogenesis is associated with attenuated NOD2 or DEFB2/HBD2 function
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912254 Results suggest a loss of protective CD4 T cells in intestinal graft-versus-host disease, which is enhanced further by NOD2/CARD15 polymorphisms.
19912254 Observational study of gene-disease association. (HuGE Navigator)
19907652 there is impaired CARD15 signalling in Crohn's disease without disease linked variants
19898471 Results link bacterial sensing by Nod proteins to the induction of autophagy and provide a functional link between Nod2 and ATG16L1.
19896081 We analyzed the 1142 G>A single-nucleotide polymorphism (SNP) in the interleukin-23 receptor gene (IL23R) and 3 SNPs in the NOD2/CARD15 gene in a cohort of 231 children who underwent allogeneic stem cell transplantation and/or their respective donors.
19896081 Observational study of gene-disease association. (HuGE Navigator)
19888426 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19880660 NOD2 up-regulation is part of the odontoblast immune response to Gram-positive bacteria and might be important in protecting human dental pulp from the deleterious effects of cariogenic pathogens.
19853919 2'-5'-oligoadenylate synthetase type 2 (OAS2), a dsRNA binding protein involved in the pathway that activates RNase-L, is identified as a new binding partner for NOD2.
19843337 Variation in the innate immunity genes CARD4, CARD8 and CARD15 is unlikely to play a major role in the susceptibility to CRC in the German population.
19843337 Observational study of gene-disease association. (HuGE Navigator)
19830732 Data show that knockdown of NOD2 and TLR2 by siRNA significantly reduced PGN-mediated chemokine production, suggesting that both NOD2 and TLR2 are required for maximal response.
19826411 NOD2 mutations are risk factors of Crohn's disease in African-Americans
19826411 Observational study of gene-disease association. (HuGE Navigator)
19822951 Blau syndrome-related CARD15/NOD2 mutations are not linked to idiopathic uveitis.
19822951 Observational study of gene-disease association. (HuGE Navigator)
19809335 Observational study of gene-disease association. (HuGE Navigator)
19787357 Meta-analysis: NOD2 R702W, G908R, and 3020insC polymorphisms contribute to colorectal cancer susceptibility in Caucasians.
19760754 Observational study of gene-disease association. (HuGE Navigator)
19759286 DUOX2 and NOD2 cooperatively facilitate antibacterial action.
19748964 Observational study of gene-disease association. (HuGE Navigator)
19728064 Increased bacterial killing activity of macrophages in Nod2(2939iC) transgenic mice could be via nuclear factor-kappaappaB/interleukin-1beta signaling.
19721713 the NOD2/RIP2 pathway has a role in recognition of Yersinia, but caspase-12 does not modulate innate host defense against Y. pestis
19713276 The per-allele risk of Crohn disease was markedly higher for Leu1007fsinsC than for Arg702Trp and Gly908Arg variants of NOD2 gene.
19701969 Observational study of gene-disease association. (HuGE Navigator)
19701189 the function of Nod2 as a viral pattern-recognition receptor highlights the important function of Nod2 in host antiviral defense mechanisms.
19693669 Response to treatment with antiinflammatory agents in Crohn's disease is not related to NOD2/CARD15 mutations, age of diagnosis and disease behavior.
19693669 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19679608 CARD15/NOD2 polymorphisms may have a role in severe pulmonary sarcoidosis
19679608 Observational study of gene-disease association. (HuGE Navigator)
19679065 NOD2 3020insC polymorphism is associated with colorectal cancer.
19679065 Observational study of gene-disease association. (HuGE Navigator)
19667203 Data suggest a role for XIAP in regulating innate immune responses by interacting with NOD1 and NOD2 through interaction with RIP2.
19664207 Observational study of gene-disease association. (HuGE Navigator)
19659808 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19641059 The authors report the first case of granulomatous mastitis due to Corynebacterium kroppenstedtii linked to strongly impaired neutrophil responses to Nod2 agonist and a single nucleotide polymorphism within the NOD2 gene.
19638967 Reoperation for CD is correlated with stenosis at initial surgery, but not with CARD15 gene variants. This finding does not justify more aggressive prophylactic therapy on the basis of CARD15 genotype.
19638967 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19590455 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19579029 Chronic non-bacterial osteomyelitis without Crohn's disease is not associated with common CARD15 gene variants.
19579027 Report CARD15 mutations in PFAPA, a periodic fever disease, of unknown etiology, characterized by aphthous stomatitis, pharyngitis and cervical adenitis.
19572373 the selective tolerance induced by muramyl dipeptide in healthy donors was related to the modulation of a convergent nub of NOD2 and TLR4 signaling pathways
19570976 Nod2-activating ligand, muramyl peptides, was internalized through endocytosis with optimal pH ranging from 5.5 to 6.5.
19570052 NOD2/CARD15 polymorphisms are not major risk factors for common gastrointestinal diseases; however, it cannot completely exclude an association with appendicitis, anal fissure, fistula and abscess, and gastrointestinal cancer.
19535145 Data support a new function of AAMP in regulating innate immune responses initiated by the NLR protein Nod2.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19482182 results suggest that NOD2 protein expressed in human dental pulp cells and pulp tissues may play an important role in dental immune defense
19479837 NOD2-associated pediatric granulomatous arthritis can be a multisystem disorder with significant visceral involvement.
19479836 This is the first report of a pediatric granulomatous arthritis pedigree in which 4 asymptomatic members carry the E383K substitution in NOD2.
19434699 Patients with Crohn's disease and the NOD2/CARD15 mutation show a remodelling of Colonic Lymphoid Follicles in both uninvolved and actively inflamed intestines.
19434699 Observational study of gene-disease association. (HuGE Navigator)
19426395 presence of novel disease predisposing mutation in the NOD2/CARD15 gene in Asian patients with crohn disease.
19426395 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19406482 detected on all female reproductive tract tissues
19397946 genetic polymorphisms is assosiated with susceptibility to gastric cancer
19349988 We confirmed impairment in phosphorylation of hnRNP-A1 and binding of hnRNP-A1 to the IL10 locus in peripheral blood mononuclear cells from patients with Crohn's disease who bear the 3020insC mutation and have lower production of IL-10.
19337309 a CLEC16A/KIAA0350 polymorphism may have a role in NOD2/CARD15(-) Crohn's disease patients
19337309 Observational study of gene-disease association. (HuGE Navigator)
19319132 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19305026 We observed a relation between parenteral symptoms and at least one mutation of CARD15 gene and a relation between intestinal complications and L1007fs mutation.
19299732 These studies provide evidence for a clathrin- and dynamin-dependent endocytosis pathway that mediates Muramyl dipeptide uptake and NOD2 activation.
19275920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19273470 Data show that NOD1 and 2 may have a role in innate immune protection in the uterus, and NOD2 may regulate inflammation associated with menstruation.
19266573 Activation of NOD2-mediated intestinal pathway via RIP2 overexpression and phosphorylation is associated with Crohn's disease
19262523 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19253375 NOD2 Mutations Are Associated with Small Bowel Disease in Crohn's disease.
19253375 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19244164 NOD2 is expressed by freshly isolated human bone marrow CD34+ cells, whereas the expression of its close homologue NOD1 is very weak.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19235913 Observational study of gene-disease association. (HuGE Navigator)
19219079 NOD2 polymorphism screening should be used to optimize donor selection and antimicrobial prophylaxis to reduce the occurrence of aGVHD and TRM following allogeneic HSCT.
19219079 Observational study of gene-disease association. (HuGE Navigator)
19200604 Observational study of gene-disease association. (HuGE Navigator)
19189651 No polymorphisms in the NOD2 and TLR4 genes were found to be associated with the development of gastric MALT lymphoma.
19189651 Observational study of gene-disease association. (HuGE Navigator)
19184350 Data suggest that the 3020insC mutation in NOD2/CARD15 is a prevalent mutation leading to typical Crohn's disease including ileal location, stricturing and penetrating clinical types and anti-Saccharomyces cerevisiae antibody expression.
19184350 Observational study of gene-disease association. (HuGE Navigator)
19184348 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19183163 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19174806 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169908 Genetic analysis showed a heterozygous c.1814 C>A, T605N mutation in NOD2 that has not previously been described for Blau syndrome
19139201 NOD2 has a significant irole in regulating the immune reponse to Staphylococcus aureus infections.
19120480 genetic variants are associated with susceptibility to Crohn's disease, Blau syndrome,sarcoidosis and granulomatous inflammation involving the skin, eyes, and joints
19116920 NOD2 genotyping may help predict disease progression in patients with Blau syndrome/early onset sarcoidosis
19116920 Observational study of gene-disease association. (HuGE Navigator)
19112191 The three NOD2 gene mutations described above are uncommon in Indian patients with Crohn's disease
19112191 Observational study of gene-disease association. (HuGE Navigator)
19103559 From the CARD15 gene mutations in the adult Crohn's disease population the 1007finsC, while in the pediatric population the 1007finsC and the G908R were significantly associated with an increased risk for Crohn's disease.
19103559 Observational study of gene-disease association. (HuGE Navigator)
19103524 NOD2 engagement by MDP mainly triggers cytokine activation and inflammatory reactions
19098858 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19079230 studies strongly suggest that NOD2 polymorphisms are associated with Crohn's disease because they lead to a decrease in negative regulation of TLR responses occurring in the normal gut & thus a pathologic increase in responses to normal flora [review]
19074885 Observational study of gene-disease association. (HuGE Navigator)
19058231 Observational study of gene-disease association. (HuGE Navigator)
19050632 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18985712 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18976442 assessing the role of NOD2/CARD15 SNPs in 342 unrelated donor transplants shows presence of any SNPs in patients or donor resulted in an increased risk of severe GvHD which did not translate in increased mortality
18976442 Observational study of gene-disease association. (HuGE Navigator)
18972554 PAB and GAB antibodies were not associated with NOD2/CARD15 or TLR4, response to medical therapy, or need for surgery. No associations were found in UC.
18972554 Observational study of gene-disease association. (HuGE Navigator)
18942754 analyses showed positive associations between proinflammatory polymorphisms at IL1RN and TNFA-307 loci and UC, as well as polymorphisms in the NOD2 gene and CD.
18942754 Observational study of gene-disease association. (HuGE Navigator)
18942751 Observational study of gene-disease association. (HuGE Navigator)
18938111 NOD2(+) mast cells have specific pathogenic roles that involve the recruitment of inflammatory cells in Crohn's disease.
18855982 Evidence for the involvement of NOD2 in regulating colonic epithelial cell growth and survival.
18824555 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18819462 Despite high frequency of constitutional mutations occurrence in NOD2 gene in women with ovarian cancer, genetic testing seem not to be justified in all women diagnosed with this disease.
18819462 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18804983 Observational study of gene-disease association. (HuGE Navigator)
18787464 CARD15 carriers, especially L1007fs mutants, in central Europeans have an increased risk of Crohn Disease and it is associated with earlier onset, ileal, fibrostenotic disease and a higher risk of surgery.
18787464 Observational study of gene-disease association. (HuGE Navigator)
18758419 Data show that the P286S, R702W, G908R, and 1007fs mutations of Nod2 were more frequent among colorectal cancer patients than controls and that the presence of the 1007fs variant might also be associated with young patient age.
18758419 Observational study of gene-disease association. (HuGE Navigator)
18756601 Determine OCTN1/2 and CARD15 gene polymorphisms in Chinese patients with inflammatory bowel disease.
18756601 Observational study of gene-disease association. (HuGE Navigator)
18715515 Observational study of gene-disease association. (HuGE Navigator)
18698678 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18680223 In inflammatory bowel disease patients selected from Southern Italy, the NOD2/CARD15, but not TLR4 single nucleotide polymorphisms, are associated with increased risk of Crohn's disease.
18680223 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18670786 Observational study of gene-disease association. (HuGE Navigator)
18647548 study associated allele E469 of the ICAM-1 gene with Crohn disease(P = 0.0024); results support previous findings about participation of mutations of NOD2 and ICAM-1 genes in inflamatory bowel disease
18640012 data indicate a rather minor role of NOD2 mutations in the pathogenesis of inverse acne in patients of German origin
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18619921 Observational study of gene-disease association. (HuGE Navigator)
18617779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18594982 Duration of disease and ethnicity, irrespective of NOD2/CARD15 genotype and age of onset, were the only predictors for penetrating or stricturing disease in pediatric patients with Crohn's disease.
18594982 Observational study of gene-disease association. (HuGE Navigator)
18576390 These findings support the use of monogenic loci as candidates for investigating the genetic component of complex disease and provide preliminary evidence of association between SNPs in autoinflammatory genes and psoriatic JIA.
18576390 Observational study of gene-disease association. (HuGE Navigator)
18574154 These data indicate that the NLR family members Nod1 and Nod2 have different functions in controlling inflammation, and that intracellular Nod1-Nod2 interactions may determine the severity of arthritis in this experimental model.
18573991 in innate immune responses to invading microbes, a combination of signaling through TLRs and NOD1/2 leads to the synergistic activation of antibacterial responses in the oral epithelium.
18563169 Population-specific NOD2/CARD15 exonic variants do not account for the high-Crohn's disease prevalence in Scotland
18563169 Observational study of gene-disease association. (HuGE Navigator)
18541930 The R702W mutation of CARD15 gene was associated with Crohn's disease in the Iranian population.
18541930 Observational study of gene-disease association. (HuGE Navigator)
18521924 Observational study of gene-disease association. (HuGE Navigator)
18521914 ATG16L1, IBD5, and IL23R SNPs were significantly associated with Crohn's Disease
18521914 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18507017 NOD-2 is not a risk factor for gastric carcinogenesis in the Caucasian population.
18507017 Observational study of gene-disease association. (HuGE Navigator)
18489434 The age at CD onset was strongly modified by positivity for the CARD15 1007fs allele: it was present in 42% pediatric-onset and only 25% adult-onset patients.
18489434 Observational study of gene-disease association. (HuGE Navigator)
18466472 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18438406 Observational study of gene-disease association. (HuGE Navigator)
18433468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18419343 Three common nonsynonymous single-nucleotide polymorphisms--Pro268Ser, Arg702Trp, and Ala725Gly--demonstrated significant associations with tuberculosis in African American patients.
18419343 Observational study of gene-disease association. (HuGE Navigator)
18413660 Inhibition of NOD2 signaling and target gene expression by curcumin are reported.
18384487 Observational study of gene-disease association. (HuGE Navigator)
18383179 The finding of increased basal levels for IL-12p40-related cytokines in monocytes with 2 mutated NOD2 alleles is likely to set a new link between NOD2 mutations and the inflammatory mechanisms underlying CD.
18383179 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18382655 TLR4 and NOD2 gene variants are associated with a pro-inflammatory phenotype with a history of early-onset preeclampsia and HELLP syndrome
18382655 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18371140 NOD2/CARD15 variants may predispose to an altered intestinal microflora in perianal fistulas that is less responsive to antibiotic treatment.
18371140 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18371139 Observational study of gene-disease association. (HuGE Navigator)
18367950 Observational study of gene-disease association. (HuGE Navigator)
18341489 CD, smoking predicts recurrence after surgery. The role of CARD15 mutations in the clinical course of CD remains undefined
18340358 The effect of NOD2 activation on TLR2-mediated cytokine responses is dependent on activation dose and NOD2 genotype in Crohn's Disease patients.
18317454 NOD2 (nucleotide-binding oligomerization domain containing 2) Single nucleotide polymorphisms had no impact on incidence of acute graft versus host disease or transplantation related mortality following Allogeneic-Stem cell transplantation.
18317454 Observational study of gene-disease association. (HuGE Navigator)
18305068 Reduction in alpha-defensin expression is independent of NOD2 status and is due to loss of surface epithelium as a consequence of inflammatory changes rather than being the inciting event prior to inflammation in ileal Crohn's disease.
18271063 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18256385 Data propose that the CD147-NOD2 interaction serves as a molecular guide to regulate NOD2 function at sites of pathogen invasion.
18253730 Nod2 mutations are associated with Crohn's disease
18248772 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18243161 When Nod2 is activated the NF-kappaB pathway downstream of it is negatively regulated.
18240302 MoDCs could be involved in CD onset because they have defects in releasing inflammatory cytokines and in polarizing T-cell responses.
18227809 This study supports the hypothesis that NOD2 contributes to liver injury via a regulatory mechanism affecting immune cells infiltrating the liver and hepatocytes.
18219096 Crohn's disease-linked CARD15 polymorphisms do not seem to predispose to idiopathic uveitis in the Spanish population.
18219096 Observational study of gene-disease association. (HuGE Navigator)
18213697 A novel NOD2 haplotype strengthens the relationship between TLR4 A299G and these phenotypes.
18213697 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
18200510 CARD15 and IL23R confer susceptibility to CD in the Brazilian population. However, the presence of these variants did not influence disease phenotype.
18200510 Observational study of gene-disease association. (HuGE Navigator)
18200509 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18184136 High incidence of HD in Sicily may indicate a genetic predisposition, where an important role may be played by the 1007fs mutation.
18182678 Observational study of gene-disease association. (HuGE Navigator)
18166373 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18162085 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18158963 Observational study of gene-disease association. (HuGE Navigator)
18158963 Multivariate analysis proved recipient but not donor NOD-like receptor C2 (NOD2/CARD15) variants to be a novel independent risk factor for bronchiolitis obliterans
18157816 caspase-1-dependent and -independent mechanisms are involved in the synergy between NOD2 and TLR.
18096043 The results suggest complex parallel control mechanisms that independently regulate NOD2 expression in the context of inflammatory signaling.
18092345 Altered mechanisms regulating NOD2 induction, NF-kappaB activation and cytokine production may contribute to dysregulate the innate immune response underlying pediatric CD.
18092344 We found neither evidence for genetic interactions between p.C10X and NOD2 nor the C10X variant to be associated with a CD or UC phenotype.
18092344 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18090989 Observational study of gene-disease association. (HuGE Navigator)
18088053 The difference between NOD2/CARD15 variant carriers and wildtype cases was not present in early-onset CD.
18069758 Dendritic cells obtained from Crohn's disease patients with mutations in the NOD2 gene display an activated phenotype characterized by high CD86 expression.
18052659 Observational study of gene-disease association. (HuGE Navigator)
18047543 gASCA and AMCA antibodies were associated with NOD2/Card15 genotype in Crohn disease
18028374 it is proposed that absence of NOD2/TLR4 cross-tolerance as a central mechanism for the increased susceptibility to Crohn's disease in individuals with 3020insC NOD2 mutations
18022871 CARD15 activity was dependent on the presence of GRIM-19 and decreased expression of GRIM-19 caused a diminished NF-kappaB activation.
18022867 Observational study of gene-disease association. (HuGE Navigator)
17980027 Although NOD2 could be important in local immune response mechanisms, none of the analyzed CARD15 variants seem to play a significant role in the etiology of CHD
17978873 1007fs, G908R, R720W mutations and P268S, IVS8+158 polymorphisms of the CARD15 gene were analyzed in 130 Turkish inflammatory bowel disease patients. No important relationship was detected.
17978873 Observational study of gene-disease association. (HuGE Navigator)
17976376 NOD2 activation, but not toll-like receptor stimulation, induces chitinase expression in macrophages
17968944 Of 12 cases, 58.3% were sporadic; Four different missense mutations on exon 4 were detected, two of them (R334W and R334Q) were recurrent and were found in 77.8% of the Spanish families, whereas the other 2 (C495Y and R587C) were novel in Blau syndrome
17964870 Carriage of the NOD2 gene mutation does not increase susceptibility for Crohn's disease in the Hungarian population.
17964870 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17964196 important role for NOD2/CARD15 genotyping in transplantation and suggest a possible effect of the NOD2 protein in alloreactivity and tumour surveillance.
17941079 We did not identify any novel major variants in the CARD15 coding region of potential relevance to Crohn disease. We identified 5 novel CARD15 mutations with an apparent physiological role, but could not identify a putative Finnish founder mutation.
17941079 Observational study of genotype prevalence. (HuGE Navigator)
17911997 CARD15/NOD2 polymorphism associated with CD has a comparable role in HS.
17907287 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17907287 Suggest population differences in the inheritance of NOD1 polymorphism and NOD2 mutations. Relationship between disease location and Nod-like receptor molecules was established.
17894849 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17892524 The absence of known inflammatory bowel disease susceptibility variants and potential associations between SNP5 and ulcerative colitis in North Indians suggests the presence of allelic heterogeneity for ulcerative colitis susceptibility.
17892524 Observational study of gene-disease association. (HuGE Navigator)
17877509 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17876878 Observational study of genotype prevalence. (HuGE Navigator)
17876878 The incidence of Crohn's disease in North-western Greece has risen disproportionately to that of ulcerative colitis in the 21st century. This is not related to statistical differences in CARD15 variants over the study period.
17852840 Mutations in CARD15 and smoking confer susceptibility to Crohn's disease in the Danish population.
17852840 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17804789 Observational study of gene-disease association. (HuGE Navigator)
17804789 NOD2 is an established gene locus for Crohn Disease.
17786191 There was no evidence for epistasis between the IL23R gene and the Crohn's disease susceptibility genes CARD15 and SLC22A4/5.
17786191 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17763471 Observational study of gene-disease association. (HuGE Navigator)
17725592 The previously reported association between SI and CARD15 polymorphisms in Crohns disease was not confirmed.
17724347 Observational study of gene-disease association. (HuGE Navigator)
17724347 data indicate an unrecognized role for the NOD2/CARD15 gene in unrelated donor hematopoietic stem cell transplantation for acute leukemia; increased risk of disease relapse suggests the wild-type gene product may contribute to graft-versus-leukemia effect
17719742 There is no significant association between variants in the novel NOD2 promoter region and Crohn's disease.
17705850 No significant differences in NOD2 transcriptional responses were detected in pulmonary tuberculosis. In some patients, however, NOD2 expression was markedly increased and correlated with toll-like-receptor 2 and 4 expression.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17684544 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17666747 Observational study of gene-disease association. (HuGE Navigator)
17666747 A major association of NOD2/CARD15 SNPs with the occurrence of severe graft-vs-host disease.
17661913 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17660460 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17652449 TLR2, TLR4, and NOD2 are involved in the recognition of M. paratuberculosis by the innate immune system.
17620097 Observational study of gene-disease association. (HuGE Navigator)
17613538 Observational study of gene-disease association. (HuGE Navigator)
17613538 NOD2/CARD15 variant carriage had no influence on NOD1/CARD4 effect on inflammatory bowel disease susceptibility.
17600378 Observational study and meta-analysis of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17595233 Observational study of gene-disease association. (HuGE Navigator)
17570063 Results suggest that the emergence of aseptic abscess syndrome is not closely related to gene NOD2/CARD15. NOD2/CARD15 might enhance the expression of aseptic abscess as a result of a combination of polymorphisms.
17570063 Observational study of gene-disease association. (HuGE Navigator)
17565648 Observational study of gene-disease association. (HuGE Navigator)
17563761 Blockade of TLR2 or NOD2 abolished PGN-induced HMC-1 cell activation and T84 monolayer barrier dysfunction.
17558906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17558494 Observational study of gene-disease association. (HuGE Navigator)
17558494 Our findings indicate a major role of NOD2/CARD15 coding variants for sepsis related mortality
17548659 DMBT1 is a target gene for the intracellular pathogen receptor NOD2 via NF-kappaB activation.
17538984 Observational study of gene-disease association. (HuGE Navigator)
17538984 The association between NOD2 mutations and CD was found to be weaker in our population-based cohort than in previous studies that used referral-based cohorts.
17509030 Observational study of gene-disease association. (HuGE Navigator)
17498224 Observational study of gene-disease association. (HuGE Navigator)
17498224 We found different effects of NOD2/CARD15 haplotypes on disorders, like cardiovascular and all-cause mortality,which may be considered at least in part as chronic inflammation-driven.
17489054 i the Dutch population, CARD15 G908R and L1007fs are associated with Crohn's disease
17486745 Although CARD15 variants do not predict response to the TNF alpha monoclonal antibodies, there are no data available on the possible influence of CARD15 mutations on response to other drugs.
17484864 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17484863 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17484863 Within Crohn's disease, there were no subphenotype associations or evidence of interaction with CARD15.
17476680 Observational study of gene-disease association. (HuGE Navigator)
17476680 polymorphisms 3020insC in CARD15 and SNP rs2165047 in DLG5 may have a role in pediatric-onset Crohn's disease
17460484 Possible mechanisms of Crohn's disease caused by NOD2 mutations are discussed (Review)
17452051 These results suggest that anti-PR3 Abs prime human monocytic cells to produce cytokines upon stimulation with various bacterial components by up-regulating the TLR and NOD signaling pathway.
17451203 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17451203 polymorphisms associated with pediatric onset of Crohn's disease
17447842 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17435756 Genome-wide association study of gene-disease association. (HuGE Navigator)
17417801 Observational study of gene-disease association. (HuGE Navigator)
17404888 Observational study of gene-disease association. (HuGE Navigator)
17404888 CARD15 mutations are associated with terminal ileal/ileocolonic, and to a lesser extent, fibrostenosing CD.
17403538 epithelial cells, did not secrete IL-6, IL-8 or monocyte chemoattractant protein-1 in response to NOD1 and NOD2 agonists; stimulation with NODs ligands induced beta-defensin 2 generation in all epithelial cells examined
17393391 This is the first report of a CARD15 mutation-positive patient with Blau syndrome who exhibited interstitial lung disease.
17389035 Observational study of gene-disease association. (HuGE Navigator)
17389035 Unlikely that NOD2/CARD15 mutations alone are responsible for the development of sporadic colorectal cancer.
17389014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17379562 role of NOD2 mutations in Crohn disease [review]
17356065 Modulation of NOD2-dependent NF-kappa B signaling by the actin cytoskeleton was studied.
17355968 NOD2 is responsible for the membrane recruitment of RICK to induce a regulated NF-kappaB signaling and production of proinflammatory cytokines.
17351900 Observational study of gene-disease association. (HuGE Navigator)
17351900 Our results indicate that NOD2 variants R702W, G908R and 3020insC do not predispose to colorectal cancer in Finland
17337463 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17333217 Observational study of gene-disease association. (HuGE Navigator)
17319929 Observational study of genotype prevalence. (HuGE Navigator)
17319929 CARD15/NOD2 mutations in healthy Caucasian; data confirm that CARD15/NOD2 acts in interaction with other unknown risk cofactors for Crohn's disease
17303577 Nod2 signaling pathways is modulated by fatty acids in human colonic cells
17301648 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17301648 a significant association of CARD15 gene mutations in our Italian Crohn's disease population and the impact of different NOD2/CARD15 mutations on specific disease phenotypes
17285593 Observational study of gene-disease association. (HuGE Navigator)
17278126 Observational study of gene-disease association. (HuGE Navigator)
17269998 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17258734 Observational study of gene-disease association. (HuGE Navigator)
17206688 Observational study of gene-disease association. (HuGE Navigator)
17206636 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17206080 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17200669 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17174426 Observational study of gene-disease association. (HuGE Navigator)
17174426 The results of the study suggest, that the polymorphism in CARD15/NOD2 gene may be a risk factor for sporadic PD development, and support the concept of inflammatory pathogenesis of PD.
17171451 Observational study of gene-disease association. (HuGE Navigator)
17160430 Observational study of gene-disease association. (HuGE Navigator)
17157607 Blau syndrome is a rare autosomal-dominant disease associated with CARD15/NOD2 missense mutatation.
17156193 Both NOD1 and NOD2 were expressed by first trimester placental villi and localized to trophoblast cells
17156146 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17142621 CARD15 3020insC mutation could be one genetic factor involved in impairment of intestinal barrier function.
17131470 Meta-analysis of gene-disease association. (HuGE Navigator)
17131470 Meta-analysis confirmed significant associations between NOD2/CARD15 variants and both ileal and ileocolonic Crohn's disease locations, and with both stricturing and penetrating forms of disease behavior.
17119385 Observational study of gene-disease association. (HuGE Navigator)
17119385 The presence of the CARD15 1007fs variant was associated with an increased risk of an intestinal stenosis.
17113749 Observational study of gene-disease association. (HuGE Navigator)
17113749 CARD15 is not a major susceptibility gene for Ttuberculosis in South African Coloureds.
17101573 Observational study of gene-disease association. (HuGE Navigator)
17100976 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17100976 CARD15/NOD2, family history, smoking, and Jewish ethnicity are independent risk factors for CD.
17100974 Observational study of gene-disease association. (HuGE Navigator)
17096091 the NOD2 mutation associated with Blau syndrome (BS) alters host:microbial interaction, and this may have relevance to triggering factors in the ocular and joint inflammation seen in BS
17057186 CARD15/NOD2 is a gene coding for a protein involved in bacterial recognition by cells involved in innate immunity, but mutations are not necessarily involved in Crohn disease [REVIWE]
17030188 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17020469 Observational study of gene-disease association. (HuGE Navigator)
17018387 Observational study of gene-disease association. (HuGE Navigator)
17018387 NOD2 genetic variants have a deleterious effect on clinical outcome in t-cell depleted allogenic stem cell transplantation independent of Graft versus Host Disease.
17012967 Observational study of gene-disease association. (HuGE Navigator)
17009307 Blau syndrome and its sporadic counterpart, early-onset sarcoidosis, share an identical phenotype featuring the classic triad of arthritis, dermatitis, and uveitis and are associated with mutations of CARD15 in 50-90% of cases.
17006998 Observational study of gene-disease association. (HuGE Navigator)
17006998 The frequency of the NOD2/CARD15 susceptibility variants in the Hungarian pediatric CD population is high. SLC22A4 and SLC22A5 mutation screening do not confirm the assumption that the carriage of these genotypes means an obligatory susceptibility to CD.
17005562 CENTB1 selectively down-regulates NF-kappaB activation via NODs pathways, creating a "feedback" loop and suggesting a novel role of CENTB1 in innate immune responses to bacteria and inflammatory responses
16977346 Observational study of gene-disease association. (HuGE Navigator)
16977346 results of the present study suggest that NOD2 allele variants have no significant influence on RA susceptibility, activity, and severity.
16965521 Observational study of gene-disease association. (HuGE Navigator)
16952484 Observational study of gene-disease association. (HuGE Navigator)
16952484 CARD15-TNFalpha circuit that might play a role in mucosal immune surveillance
16949315 NOD2 abnormality in transgenic mice leads to susceptibility to colitis as a result of increased TLR2 responses, when they have the capacity to respond to an antigen expressed by mucosal bacteria.
16933467 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16933467 A mutation in CARD15 is associated with sarcoidosis.
16920047 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16907704 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16897777 These data suggest a critical role of NOD2/CARD15 in the bacterial clearance of the intestinal epithelium while Crohn's disease (CD)-specific mutated NOD2/CARD15 causes an impaired epithelial barrier.
16840031 Observational study of gene-disease association. (HuGE Navigator)
16825909 Observational study of gene-disease association. (HuGE Navigator)
16819374 Observational study of genotype prevalence. (HuGE Navigator)
16819374 Genotyping NOD2/CARD15 may help to distinguish ileal lymphonular hyperplasia from inflammatory bowel diseases in selected patients.
16804670 Observational study of gene-disease association. (HuGE Navigator)
16804398 Observational study of gene-disease association. (HuGE Navigator)
16804398 analysis of the NFKB1 protein polymorphism interactions with CARD15/NOD2, IKBL, and IL-1RN genes
16773683 The identification of NOD2 and the differences within and across population raises intriguing questions about the population genetics of the variation at this locus associated with susceptibility to Crohn's disease.
16771961 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16741608 Observational study of gene-disease association. (HuGE Navigator)
16741608 Polymorphism observed in the NOD2/CARD15 gene is not genetic susceptibility factors for Crohn's disease or ulcerative colitis in Turkey.
16716969 Observational study of gene-disease association. (HuGE Navigator)
16716969 CARD15 is associated with susceptibility to Crohn disease in Sweden.
16670524 Observational study of gene-disease association. (HuGE Navigator)
16670523 Observational study of gene-disease association. (HuGE Navigator)
16669960 Observational study of gene-disease association. (HuGE Navigator)
16642031 Observational study of gene-disease association. (HuGE Navigator)
16642031 The data suggest that both the CARD15 gene and the IBD5 locus may have a role as general susceptibility loci for certain common, genetically complex inflammatory diseases.
16641610 Observational study of gene-disease association. (HuGE Navigator)
16614992 Observational study of gene-disease association. (HuGE Navigator)
16614992 CARD15 mutation have been shown to increase the risk for Chrohn disease in Caucasian population.
16611251 Observational study of gene-disease association. (HuGE Navigator)
16534418 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16522788 prevalence of Nod2 polymorphisms is not increased in patients with Candida infections; unlikely to play an important role in the recognition of Candida albicans.
16519819 Observational study of gene-disease association. (HuGE Navigator)
16510569 Observational study of gene-disease association. (HuGE Navigator)
16510569 CARD15 influences susceptibility to colorectal cancer, but we have found no evidence to indicate that CARD15 mutations predict the clinicopathologic characteristics of this disease.
16494592 Observational study of gene-disease association. (HuGE Navigator)
16494109 Observational study of gene-disease association. (HuGE Navigator)
16493449 An emerging pattern of a low frequency of the CARD15 variants is consistent in northern European countries where the prevalence of inflammatory bowel disease is greatest.
16493449 Observational study of gene-disease association. (HuGE Navigator)
16493424 Review focuses on the molecular interactions by which NOD1 and NOD2 contribute to the maintenance of mucosal homeostasis and the induction of mucosal inflammation.
16492792 NOD2-S interacts with both, NOD2 and receptor-interacting protein kinase 2 and inhibits the "nodosome" assembly by interfering with the oligomerization of NOD2
16489646 Observational study of gene-disease association. (HuGE Navigator)
16485124 Observational study of genotype prevalence. (HuGE Navigator)
16485124 Eight novel amino acid substitutions were detected in inflammatory bowel diseases patients.
16461743 The NOD2 mutation results in a loss-of-function phenotype in human myeloid DC and imply decreased immune regulation by IL-10 as a possible mechanism for this mutation in CD.
16454837 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16454837 Presence of the IBD5 risk alleles, particularly in the homozygous state, is associated with IBD and especially with CD, without a significant epistasis with CARD15.
16446977 Observational study of gene-disease association. (HuGE Navigator)
16441470 Observational study of gene-disease association. (HuGE Navigator)
16437728 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16437636 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16436969 Observational study of gene-disease association. (HuGE Navigator)
16436969 NOD2 mutations have influence on the occurrence of acute GVHD after transplantation.
16424393 Observational study of gene-disease association. (HuGE Navigator)
16424393 role of NOD2/CARD15 variants on the long-term outcome of allogeneic stem cell transplantation in a genetically homogeneous group
16416181 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16416181 CARD15 gene polymorphism is associated in patients diagnosed with gastroduodenal Crohn disease.
16402184 Observational study of gene-disease association. (HuGE Navigator)
16397396 Observational study of gene-disease association. (HuGE Navigator)
16393227 Observational study of gene-disease association. (HuGE Navigator)
16389181 Observational study of gene-disease association. (HuGE Navigator)
16385250 Observational study of gene-disease association. (HuGE Navigator)
16344054 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16344053 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16319062 NOD2 serves as an intracellular pattern recognition receptor to enhance host defense by inducing the production of antimicrobial peptides such as hBD-2
16315780 Observational study of gene-disease association. (HuGE Navigator)
16315780 NOD2/CARD15 gene is not likely to be involved in susceptibility to idiopathic pulmonary fibrosis in Italians.
16306764 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16279904 Observational study of gene-disease association. (HuGE Navigator)
16278823 Observational study of gene-disease association. (HuGE Navigator)
16278823 Analysis of the evolution of CARD15 revealed strong conservation of the encoded protein, with identity to the human sequence ranging from 99.1% in the chimp to 44.5% in fugu.
16267612 Observational study of gene-disease association. (HuGE Navigator)
16267612 NOD2 mutation is associated with breast and lung cancer
16266221 Observational study of gene-disease association. (HuGE Navigator)
16260731 IL-32 synergizes with nucleotide oligomerization domain (NOD) 1 and NOD2 ligands for IL-1beta and IL-6 production through a caspase 1-dependent mechanism.
16257953 genetic variations in the NOD2 gene may have roles in the pathophysiology of chronic inflammatory bowel disease
16255050 Observational study of gene-disease association. (HuGE Navigator)
16244543 Observational study of gene-disease association. (HuGE Navigator)
16239841 Observational study of gene-disease association. (HuGE Navigator)
16239840 Observational study of gene-disease association. (HuGE Navigator)
16230083 Mutated in Crohn disease at the muramyl dipeptide site.
16203728 Erbin is a regulator of Nod2-dependent NF-kappaB signaling with a role in inflammatory responses
16198136 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16198136 found no evidence for association of CARD15 (NOD2) variants with T1D
16179784 Observational study of gene-disease association. (HuGE Navigator)
16174099 Observational study of gene-disease association. (HuGE Navigator)
16167972 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16161956 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16148063 Observational study of gene-disease association. (HuGE Navigator)
16134731 Observational study of gene-disease association. (HuGE Navigator)
16134725 Observational study of gene-disease association. (HuGE Navigator)
16134725 These data suggest that CARD15 variants are not associated with rheumatoid arthritis susceptibility.
16133971 Observational study of gene-disease association. (HuGE Navigator)
16126943 Observational study of gene-disease association. (HuGE Navigator)
16115863 there is cross-talk between the Nod1 and Nod2 pathways; down-regulation of the Nod1/M-Tri(DAP) pathway may be associated with Crohn disease
16080653 Observational study of gene-disease association. (HuGE Navigator)
16010583 Observational study of gene-disease association. (HuGE Navigator)
16009674 Observational study of gene-disease association. (HuGE Navigator)
16008671 Observational study of gene-disease association. (HuGE Navigator)
16002353 Observational study of gene-disease association. (HuGE Navigator)
16002353 CARD15/NOD2 polymorphisms contribute but do not alone explain concordance of Crohn's disease in monozygotic twins.
16000642 Observational study of gene-disease association. (HuGE Navigator)
15998797 The membrane targeting of NOD2 is required for NF-kappaB activation after the recognition of bacterial muramyl dipeptide in intestinal epithelial cells.
15990626 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15984988 Observational study of gene-disease association. (HuGE Navigator)
15973118 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15973116 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15973116 CARD15 mutational frequencies are not increased among African American or Hispanic children with Crohn's disease compared with Whites.
15967635 Observational study of gene-disease association. (HuGE Navigator)
15967635 A725G mutation has a possible role in inflammatory bowel disease expression
15930978 CARD15 disease susceptibility alleles engendered a 7.5-fold increase in risk for Crohn disease.
15927452 Nod2 has a role in inflammatory granulomatous disorders [review]
15843082 Observational study of gene-disease association. (HuGE Navigator)
15842589 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15840263 Observational study of gene-disease association. (HuGE Navigator)
15807862 Observational study of gene-disease association. (HuGE Navigator)
15803022 Observational study of gene-disease association. (HuGE Navigator)
15800781 CARD15 and TNFalpha promoter polymorphisms interact to exert functional effect on MDP-induced TNFalpha production; this gene-gene interaction may contribute to interindividual variation in susceptibility to Crohn's disease
15795594 Observational study of gene-disease association. (HuGE Navigator)
15785318 Observational study of gene-disease association. (HuGE Navigator)
15778542 Observational study of gene-disease association. (HuGE Navigator)
15770725 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15770725 Variant NOD2/CARD15 (R702W, R703C and 3020insC) alleles are associated with earlier disease onset, ileal disease, stricturing disease behavior in Hungarian Crohn's disease. NOD2/TLR4 mutation carriers tended to present at earlier age.
15753091 GRIM-19 may be a key component in NOD2-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes
15712650 Observational study of gene-disease association. (HuGE Navigator)
15712650 Frequency of CARD15 variants in Tunisian population is significantly lower than that observed in European and American population. No association was confirmed between Crohn's disease and NOD2 gene in our Tunisian population.
15685536 Observational study of gene-disease association. (HuGE Navigator)
15685536 CARD15 disease susceptibility alleles engendered a 7.5-fold increase in risk for Crohn disease.
15667501 Observational study of gene-disease association. (HuGE Navigator)
15666202 Observational study of gene-disease association. (HuGE Navigator)
15666202 DCIS and early-onset breast cancer associated with the 3020insC allele of NOD2
15655821 Observational study of gene-disease association. (HuGE Navigator)
15655821 co-existence of a mutation in either the TLR4 or CD14 gene, and in NOD2/CARD15 is associated with an increased susceptibility to developing Crohn disease compared to ulcerative colitis
15654786 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15643611 Observational study of gene-disease association. (HuGE Navigator)
15638227 Observational study of gene-disease association. (HuGE Navigator)
15637755 Observational study of gene-disease association. (HuGE Navigator)
15637755 NOD2/CARD15 mutations are frequently found in Crohn's disease patients from Hungary. The 1007finsC mutation is associated with stenotic disease behaviour and frequent ileal resections.
15626888 Observational study of gene-disease association. (HuGE Navigator)
15626887 Observational study of gene-disease association. (HuGE Navigator)
15578724 Observational study of gene-disease association. (HuGE Navigator)
15571588 Meta-analysis of gene-disease association. (HuGE Navigator)
15571586 Observational study of gene-disease association. (HuGE Navigator)
15551253 Observational study of gene-disease association. (HuGE Navigator)
15539413 Observational study of gene-disease association. (HuGE Navigator)
15539411 Observational study of gene-disease association. (HuGE Navigator)
15527324 Observational study of genetic testing. (HuGE Navigator)
15520108 Observational study of gene-disease association. (HuGE Navigator)
15520108 The NOD2 genotype was not correlated with growth retardation or growth failure in Crohn's disease but was correlated with ileal location.
15516360 Observational study of gene-disease association. (HuGE Navigator)
15515785 Observational study of gene-disease association. (HuGE Navigator)
15515785 These findings suggest that 3 most common Crohn's Disease-predisposing CARD15 variants do not constitute a genetic susceptibility factor for Behcet's Disease in Turkey.
15492242 Observational study of gene-disease association. (HuGE Navigator)
15492242 Loss of heterozygosity at NOD2 was observed in only 1 of the 33 colorectal cancer samples. Results suggest that NOD2 3020insC alone does not contribute to CRC risk.
15489579 Observational study of gene-disease association. (HuGE Navigator)
15479689 Observational study of gene-disease association. (HuGE Navigator)
15472511 Observational study of gene-disease association. (HuGE Navigator)
15468360 Observational study of gene-disease association. (HuGE Navigator)
15459013 In early-onset sarcoidosis and Blau syndrome share the common genetic etiology of CARD15 mutations that cause constitutive NF-kappaB activation.
15377357 Observational study of gene-disease association. (HuGE Navigator)
15367194 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15320482 Observational study of gene-disease association. (HuGE Navigator)
15320482 In concordance with European data we found a high number of NOD2/CARD15 R702W and 3020insC mutations in Hungarian patients with Crohn's disease.
15308523 Observational study of gene-disease association. (HuGE Navigator)
15289769 Observational study of gene-disease association. (HuGE Navigator)
15279649 Observational study of gene-disease association. (HuGE Navigator)
15279649 3020insC mutation does not seem to influence the pathophysiology of periodontitis
15214053 defective NOD2 function results in a pro-inflammatory cytokine bias after stimulation of mononuclear cells with TLR2 stimuli
15202784 Observational study of genetic testing. (HuGE Navigator)
15194649 Observational study of gene-disease association. (HuGE Navigator)
15190267 Observational study of gene-disease association. (HuGE Navigator)
15180737 Observational study of gene-disease association. (HuGE Navigator)
15180737 NOD2/CARD15 Crohn disease associated mutations showed increased risk mainly to the Ashkenazi Jews in Israel.
15168811 Observational study of gene-disease association. (HuGE Navigator)
15168811 The association between CARD15 gene mutations and crohn disease shows a risk factor of this disease in Italian population.
15145460 Observational study of gene-disease association. (HuGE Navigator)
15142196 Observational study of gene-disease association. (HuGE Navigator)
15140210 Observational study of gene-disease association. (HuGE Navigator)
15140210 no evidence for association in the examined population for CARD15 polymorphisms in psoriatic arthritis
15107849 Mutations in card15 is associated with Crohn disease
15095853 Observational study of gene-disease association. (HuGE Navigator)
15090455 Observational study of gene-disease association. (HuGE Navigator)
15090455 Association of graft vs host disease and stem cell transplantation mortality with NOD2/CARD15 single nucleotide polymorphism
15056084 Observational study of gene-disease association. (HuGE Navigator)
15052696 Observational study of gene-disease association. (HuGE Navigator)
15052696 NOD2 gene 3020insC frameshift mutation is not a major contributor to the susceptibility to both Crohn's disease and ulcerative colitis in Chinese Han patients.
15046222 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15046222 CARD15 alleles influence susceptibility and disease localization in Crohn's disease.
15046221 Observational study of gene-disease association. (HuGE Navigator)
15046221 CARD15 variants are associated with Crohn's disease and ulcerative colitis in the Flemish population. Maternal transmission of the CARD15 variant allele is associated with a lower proportion of affected individuals compared to paternal transmission.
15044951 Results identify the essential regulatory domains and specific residues of NOD2 involved in recognition of muramyl dipeptide.
15024686 Screening the CARD15 gene for rare variants revealed five novel changes (D113N, D357A, I363F, L550V, and N852S) of which N852S occurred only in Ashkenazi Jewish individuals and may be disease predisposing
15016407 in this model of natural LPS release, the variation between individuals in TNF-alpha release can only modestly be determined by genetic background (tumor necrosis factor-alpha promoter, Nod2 and toll-like receptor-4) of the individual
15008984 Observational study of gene-environment interaction. (HuGE Navigator)
15002819 Observational study of gene-disease association. (HuGE Navigator)
15002819 Three variants of the NOD2/CARD15 gene are strongly associated with susceptibility to Crohn's disease.
14996717 Observational study of gene-disease association. (HuGE Navigator)
14971813 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14750643 Observational study of gene-disease association. (HuGE Navigator)
14750643 mutations of the NOD2/CARD15 gene were a marker of susceptibility to Crohn disease
14747834 Observational study of gene-disease association. (HuGE Navigator)
14747834 association of the CARD15 genotype with behaviour and location of Inflammatory Bowel Diseases holds also for the Italian population
14743885 NOD2/CARD15, the first gene associated with IBD, is a polymorphic gene involved in the innate immune system. The gene has over 60 variations. Three of these play a role in 27% of patients with CD, with a predilection for patients with ileal disease.
14690304 REVIEW: genetics of Inflammatory bowel disease, emphasizing the discovery of CARD15 variants as susceptibility alleles for Crohn's disease and the impact of this discovery on patient care and in delineating pathogenesis of this complex disease
14644139 NOD2 (CARD15) is involved in the predisposition to Crohn's disease and Blau syndrome. Nod2 (Card15) is intracellular sensor of bacterial peptidoglycan.
14638352 Observational study of gene-disease association. (HuGE Navigator)
14638352 NOD2/CARD15 variants are associated with lower body weight at diagnosis in children with Crohn disease.
14627676 Single nucleotide polymorphisms of CARD15 do not cause susceptibility to ulcerative colitis.
14597055 Observational study of gene-disease association. (HuGE Navigator)
14597055 No mutations were found to be associated with sarcoidosis in a group of patients, regardless of the presence of uveitis.
14555911 Observational study of gene-disease association. (HuGE Navigator)
14522785 Blau syndrome should be considered in the differential diagnosis of childhood uveitis. Genetic analysis of the CARD15/Nod2 gene is helpful in the diagnosis.
14516815 A single amino acid change in NOD2 can lead to a chronic granulomatous uveitis.
14508222 Observational study of gene-disease association. (HuGE Navigator)
14508222 influence of mutations within the CARD15 protein gene on Crohn disease was more pronounced than that reported in any other study
13680285 Observational study of gene-disease association. (HuGE Navigator)
13680285 single nucleotide polymorphisms in the 3'-UTR were significantly increased only in Crohn's disease patients without a variation in the CARD15 gene.
12940436 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12930309 Observational study of gene-disease association. (HuGE Navigator)
12930309 a particular insertion mutation in the NOD2 gene does not appear to contribute to the genetic susceptibility of psoriasis in Crohn's disease.
12923865 Observational study of gene-disease association. (HuGE Navigator)
12923865 We conclude that germline mutations in the CARD15 gene are more frequently found in crohn's disease.
12879366 Observational study of gene-disease association. (HuGE Navigator)
12879366 represents a pleiotropic autoimmune gene and is the first non-MHC gene to be associated with psoriatic arthritis
12876263 Crohn's associated NOD2 gene variants are not involved in determining susceptibility to multiple sclerosis.
12871942 Using a wide array of natural or modified muramyl peptides, it is shown that Nod1 and Nod2 have evolved divergent strategies to achieve peptidoglycan sensing
12851870 The NOD2 gene product is most abundant in Paneth cells in the terminal ileum, which could therefore play a critical and hitherto unrecognized role in the pathogenesis of NOD2-associated Crohn's disease
12823148 Observational study of gene-disease association. (HuGE Navigator)
12810925 Observational study of gene-disease association. (HuGE Navigator)
12704363 Observational study of gene-disease association. (HuGE Navigator)
12673278 This report confirms the importance of NOD2 as a susceptibility gene for Crohn's Disease within the Irish population.
12671897 TNF-alpha(/IFN-gamma) treatment up-regulates the expression of the NOD2 gene in intestinal epithelial cells and this, with nod2 mutations, could be part of the complex pathophysiology of barrier disruption as it is observed in inflammatory bowel diseases.
12671896 CARD15/NOD2 is expressed in intestinal epithelial cells and may serve as a key component of innate mucosal responses to luminal bacteria as an antibacterial factor.
12650796 Although CARD15 3020insC appears to be etiologically important in Crohn's disease, homozygous carriage does not always lead to inflammatory bowel disease.
12649405 Observational study of gene-disease association. (HuGE Navigator)
12631669 Observational study of gene-disease association. (HuGE Navigator)
12631668 Observational study of gene-disease association. (HuGE Navigator)
12631666 Observational study of gene-disease association. (HuGE Navigator)
12626759 alleles of a major susceptibility gene for Crohn disease
12618963 Observational study of gene-disease association. (HuGE Navigator)
12618963 Presents genetic evidence for interaction of the 5q31 cytokine locus and this gene in Crohn disease.
12617879 The identification of the IBD1 gene on chromosome 16 as NOD-2 is unquestionably an important scientific discovery of the genetics of the inflammatory bowel diseases, Crohn's disease and ulcerative colitis.
12595906 Observational study of gene-disease association. (HuGE Navigator)
12595906 The insertion 3020insC mutation and the G2722C missense mutation in the CARD15 gene are not involved in susceptibility to ankylosing spondylitis.
12595627 Observational study of gene-disease association. (HuGE Navigator)
12577202 A haplotype in yhis gene confers a risk for Crohn disease in Ashkenazi Jews.
12563685 Observational study of gene-disease association. (HuGE Navigator)
12556233 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12556233 CARD15/NOD2 risk alleles in the development of Crohn's disease in the Australian population.
12532667 frameshift mutation in Crohn's disease
12529700 Observational study of gene-disease association. (HuGE Navigator)
12529700 The three disease-associated SNPs were absent and there was no evidence of association between CARD15 and CD. Consequently, the disease-associated mutations in the Europeans, which are rare, have arisen recently (after the Asian-European split)
12527755 Nod2 is a general sensor of peptidoglycan through muramyl dipeptide (MDP) detection
12514169 Host recognition of bacterial muramyl dipeptide mediated through this protein, and this protein is implicated in susceptibility to Crohn's disease
12512064 Observational study of gene-disease association. (HuGE Navigator)
12512038 R702W is not associated with susceptibility to Crohn's disease in Ashkenazi Jews. The G908R, R702W, and L1007fsinsC variants share a common signaling defect in response to bacterial components.
12508397 Observational study of gene-disease association. (HuGE Navigator)
12492195 Observational study of gene-disease association. (HuGE Navigator)
12492195 Familial cases of Crohn's disease had a significantly higher frequency of the G908R variant than sporadic cases and a significantly higher proportion of homozygotes and compound heterozygotes.
12459523 Observational study of gene-disease association. (HuGE Navigator)
12459523 There is not a strong genetic association between CARD15 gene polymorphisms and psoriasis in the Italian population.
12454871 Association of NOD2 genotype with clinical course of Crohn's disease.
12415614 Observational study of gene-disease association. (HuGE Navigator)
12397216 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12397216 We conclude that the CARD15 mutation and hyporesponsive TLR4 allele do not contribute to ethnic variation in the incidence of PPROM.
12360101 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12210321 Microsatellite study failed to identify NOD2 as a Crohn disease gene, despite presence of known disease alleles.
12202985 Observational study of gene-disease association. (HuGE Navigator)
12198692 Observational study of gene-disease association. (HuGE Navigator)
12198692 Mutations in NOD2 are associated with fibrostenosing disease in patients with Crohn's disease.
12115249 NOD2 mutations in spondylarthropathy.
12115195 Observational study of gene-disease association. (HuGE Navigator)
12115195 Role of NOD2 variants in spondylarthritis.
12105838 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12105838 NOD2/CARD15 does not influence response to infliximab in Crohn's disease.
12105836 Observational study of gene-disease association. (HuGE Navigator)
12105836 Lack of common NOD2 variants in Japanese patients with Crohn's disease.
12020527 Observational study of gene-disease association. (HuGE Navigator)
12019468 Observational study of gene-disease association. (HuGE Navigator)
12019468 CARD15 genetic variation in a Quebec population: prevalence, genotype-phenotype relationship, and haplotype structure.
12019209 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11976792 Observational study of gene-disease association. (HuGE Navigator)
11910337 Observational study of gene-disease association. (HuGE Navigator)
11910336 Observational study of gene-disease association. (HuGE Navigator)
11890351 nod2 protein on chromosome 16 is associated with Crohn's disease
11875755 Observational study of gene-disease association. (HuGE Navigator)
11875755 CARD15/NOD2 mutational analysis and genotype-phenotype correlation in 612 patients with inflammatory bowel disease
11837220 Crohn's disease is caused by mutations in the bacterial response protein NOD2.
11752413 Linkage of Inflammatory Bowel Disease to broad regions of chromosome 16 has been established by analysis of multiple populations. NOD2, located on proximal 16q, was recently identified as an IBD gene
11425413 Observational study of gene-disease association. (HuGE Navigator)
11385577 Observational study of gene-disease association. (HuGE Navigator)
11385576 Observational study of gene-disease association. (HuGE Navigator)
11318544 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWED      1 - 70
YEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPA     71 - 140
IVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPL    141 - 210
ALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEE    211 - 280
LFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLF    281 - 350
EHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR    351 - 420
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSW    421 - 490
MVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGM    491 - 560
CCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLRHLF    561 - 630
NCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKAL    631 - 700
LRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLT    701 - 770
FCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL    771 - 840
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNR    841 - 910
VGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLK    911 - 980
KNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL              981 - 1040
//

Text Mined References (795)

PMID Year Title
27050483 2016 Calcium-sensing receptors signal constitutive macropinocytosis and facilitate the uptake of NOD2 ligands in macrophages.
27007849 2016 NOD1 and NOD2 signalling links ER stress with inflammation.
26752466 2016 NOD2 Is Regulated By Mir-320 in Physiological Conditions but this Control Is Altered in Inflamed Tissues of Patients with Inflammatory Bowel Disease.
26752461 2016 NOD2 Loss-of-Function Mutations and Risks of Necrotizing Enterocolitis or Focal Intestinal Perforation in Very Low-birth-weight Infants.
26606664 2016 Brief Report: First Identification of Intrafamilial Recurrence of Blau Syndrome due to Gonosomal NOD2 Mosaicism.
26562405 2015 [The INCA trial (impact of NOD2 genotype-guided antibiotic prevention on survival in patients with liver cirrhosis and ascites): precision medicine for patients with liver cirrhosis and ascites].
26517420 2015 Role of NOD2 Pathway Genes in Sarcoidosis Cases with Clinical Characteristics of Blau Syndrome.
26316104 2015 Variations in inflammatory genes as molecular markers for prediction of inflammatory bowel disease occurrence.
26238283 2015 The role of NOD1/CARD4 and NOD2/CARD15 genetic variations in lung cancer risk.
26235265 2016 Association between genetic variants in NOD2, C13orf31, and CCDC122 genes and leprosy among the Chinese Yi population.
26167078 2015 NOD2/CARD15 gene mutations in North Algerian patients with inflammatory bowel disease.
26147989 2015 The NOD2 Single Nucleotide Polymorphism rs72796353 (IVS4+10 A>C) Is a Predictor for Perianal Fistulas in Patients with Crohn's Disease in the Absence of Other NOD2 Mutations.
26070941 2015 NOD2-associated autoinflammatory disease: a large cohort study.
26042516 2015 NOD2/CARD15 mutations in Polish and Bosnian populations with and without Crohn's disease: prevalence and genotype-phenotype analysis.
26019273 2015 Twist1 and Twist2 Contribute to Cytokine Downregulation following Chronic NOD2 Stimulation of Human Macrophages through the Coordinated Regulation of Transcriptional Repressors and Activators.
25988661 2015 Donor Nucleotide-Binding Oligomerization-Containing Protein 2 (NOD2) Single Nucleotide Polymorphism 13 Is Associated with Septic Shock after Allogeneic Stem Cell Transplantation.
25933107 2015 NOD1 and NOD2 Genetic Variants in Association with Risk of Gastric Cancer and Its Precursors in a Chinese Population.
25922834 2015 NOD-Like Receptor Signaling in Cholesteatoma.
25910289 2014 NOD2/CARD15 gene influences disease behaviour but not IBD susceptibility in a Moroccan population.
25840495 2015 NOD1 and NOD2 control the invasiveness of trophoblast cells via the MAPK/p38 signaling pathway in human first-trimester pregnancy.
25825396 2015 Nucleotide-binding oligomerization domain 2 receptor is expressed in platelets and enhances platelet activation and thrombosis.
25801769 2015 Role for NOD2 in Mycobacterium tuberculosis-induced iNOS expression and NO production in human macrophages.
25724124 2015 Somatic NOD2 mosaicism in Blau syndrome.
25722298 2015 Genetic Variation in Pattern Recognition Receptors and Adaptor Proteins Associated With Development of Chronic Q Fever.
25692065 2015 A new mutation in blau syndrome.
25674246 2014 Different expression of NOD2 in decidual stromal cells between normal and unexplained recurrent spontaneous abortion women during first trimester gestation.
25670499 2015 Down-regulation of human enteric antimicrobial peptides by NOD2 during differentiation of the paneth cell lineage.
25664710 2015 Genetic determinants associated with early age of diagnosis of IBD.
25649363 2014 Crohn's disease: a role of gut microbiota and Nod2 gene polymorphisms in disease pathogenesis.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25549945 2015 The crosstalk between TLR2 and NOD2 in Aspergillus fumigatus keratitis.
25367361 2014 NOD2 and CCDC122-LACC1 genes are associated with leprosy susceptibility in Brazilians.
25365249 2014 The NOD2 p.Leu1007fsX1008 mutation (rs2066847) is a stronger predictor of the clinical course of Crohn's disease than the FOXO3A intron variant rs12212067.
25335775 2015 Species-specific engagement of human nucleotide oligomerization domain 2 (NOD)2 and Toll-like receptor (TLR) signalling upon intracellular bacterial infection: role of Crohn's associated NOD2 gene variants.
25326182 2015 Aberrant expression of regulatory cytokine IL-35 and pattern recognition receptor NOD2 in patients with allergic asthma.
25259511 2014 Association of NOD2 and IL23R with inflammatory bowel disease in Puerto Rico.
25248089 2015 Association between NOD2 single nucleotide polymorphisms and Grade III-IV acute graft-versus-host disease: A meta-analysis.
25183734 2014 Recognition of Streptococcus pneumoniae and muramyl dipeptide by NOD2 results in potent induction of MMP-9, which can be controlled by lipopolysaccharide stimulation.
25171511 2014 Immuno-genomic profiling of patients with inflammatory bowel disease: a systematic review of genetic and functional in vivo studies of implicated genes.
25170077 2014 A genome-wide small interfering RNA (siRNA) screen reveals nuclear factor-?B (NF-?B)-independent regulators of NOD2-induced interleukin-8 (IL-8) secretion.
25148897 2014 A miRNA-binding site single nucleotide polymorphism in the 3'-UTR region of the NOD2 gene is associated with colorectal cancer.
25093298 2014 Blau syndrome polymorphisms in NOD2 identify nucleotide hydrolysis and helical domain 1 as signalling regulators.
25053139 2014 Genetic association between a 'standing' variant of NOD2 and bipolar disorder.
25048429 2014 Association of IL23R and ATG16L1 with susceptibility of Crohn's disease in Chinese population.
25042478 2014 Innate immune receptor NOD2 promotes vascular inflammation and formation of lipid-rich necrotic cores in hypercholesterolemic mice.
25024364 2014 Aggregatibacter actinomycetemcomitans outer membrane vesicles are internalized in human host cells and trigger NOD1- and NOD2-dependent NF-?B activation.
24960071 2014 Interaction between NOD2 and CARD9 involves the NOD2 NACHT and the linker region between the NOD2 CARDs and NACHT domain.
24932916 2014 Expression and functional characterization of NOD2 in decidual stromal cells isolated during the first trimester of pregnancy.
24901824 2014 A distinct pattern of disease-associated single nucleotide polymorphisms in IBD risk genes in a family with Crohn's disease.
24832447 2014 Endosomes as platforms for NOD-like receptor signaling.
24803813 2014 Prediction of Crohn's disease aggression through NOD2/CARD15 gene sequencing in an Australian cohort.
24790089 2014 The molecular chaperone HSP70 binds to and stabilizes NOD2, an important protein involved in Crohn disease.
24782627 2014 Association between NOD2/CARD15 gene polymorphisms and Crohn's disease in Chinese Zhuang patients.
24781050 2014 Differential effect of vitamin D on NOD2- and TLR-induced cytokines in Crohn's disease.
24722226 2014 Fungal chitin dampens inflammation through IL-10 induction mediated by NOD2 and TLR9 activation.
24719038 2014 3020insC NOD2/CARD15 polymorphism associated with treatment of colorectal cancer.
24695226 2014 Endosomes are specialized platforms for bacterial sensing and NOD2 signalling.
24682985 2014 NOD2/CARD15 variants in Malaysian patients with sporadic colorectal cancer.
24679666 2014 NOD2/CARD15 and IL23R genetic variability in 204 Algerian Crohn's disease.
24671169 2014 Activation of nucleotide oligomerization domain 2 (NOD2) by human cytomegalovirus initiates innate immune responses and restricts virus replication.
24670424 2014 NOD2 downregulates colonic inflammation by IRF4-mediated inhibition of K63-linked polyubiquitination of RICK and TRAF6.
24656308 2014 Autophagy genes variants and paediatric Crohn's disease phenotype: a single-centre experience.
24651958 2014 NOD2 gene mutations in ulcerative colitis: useless or misunderstood?
24627602 2014 ATG16L1 and NOD2 polymorphisms enhance phagocytosis in monocytes of Crohn's disease patients.
24597572 2014 Two patients with intestinal failure requiring home parenteral nutrition, a NOD2 mutation and tuberculous lymphadenitis.
24586700 2014 NOD2 polymorphisms associated with cancer risk: a meta-analysis.
24444388 2014 NOD1 and NOD2 expression and function in very preterm infant mononuclear cells.
24393249 2014 A non-interventional study of the genetic polymorphisms of NOD2 associated with increased mortality in non-alcoholic liver transplant patients.
24391456 2013 NOD2 polymorphisms and pulmonary tuberculosis susceptibility: a systematic review and meta-analysis.
24366254 2014 The Nod1, Nod2, and Rip2 axis contributes to host immune defense against intracellular Acinetobacter baumannii infection.
24360029 2014 A family study of asymptomatic small bowel Crohn's disease.
24345423 2014 NOD2/CARD15 single nucleotide polymorphism 13 (3020insC) is associated with risk of sepsis and single nucleotide polymorphism 8 (2104C>T) with herpes viruses reactivation in patients after allogeneic hematopoietic stem cell transplantation.
24298015 2014 The role of NOD2 in murine and human melioidosis.
24297055 2014 NOD2 expression is regulated by microRNAs in colonic epithelial HCT116 cells.
24295830 2014 Molecular mechanisms regulating the synergism between IL-32? and NOD for the activation of eosinophils.
24099766 2013 NOD2 triggers PGE2 synthesis leading to IL-8 activation in Staphylococcus aureus-infected human conjunctival epithelial cells.
24098051 2013 Novel regulatory action of ribosomal inactivation on epithelial Nod2-linked proinflammatory signals in two convergent ATF3-associated pathways.
24076061 2014 Genetic variants synthesize to produce paneth cell phenotypes that define subtypes of Crohn's disease.
24054330 2013 The intracellular sensor NOD2 induces microRNA-29 expression in human dendritic cells to limit IL-23 release.
24047397 2013 Card15 mutations and gastric cancer in a Portuguese population.
24018334 2013 Convergence of innate immunity and insulin resistance as evidenced by increased nucleotide oligomerization domain (NOD) expression and signaling in monocytes from patients with type 2 diabetes.
24015287 2013 LRRK2 and RIPK2 variants in the NOD 2-mediated signaling pathway are associated with susceptibility to Mycobacterium leprae in Indian populations.
23991106 2013 Protein tyrosine phosphatase non-receptor type 22 modulates NOD2-induced cytokine release and autophagy.
23977330 2013 Recipient's genetic R702W NOD2 variant is associated with an increased risk of bacterial infections after orthotopic liver transplantation.
23901396 2013 NOD1 and NOD2 receptors: integral members of the innate and adaptive immunity system.
23892590 2014 The pattern recognition receptor NOD2 mediates Staphylococcus aureus-induced IL-17C expression in keratinocytes.
23888881 2013 Allergy to betalactams and nucleotide-binding oligomerization domain (NOD) gene polymorphisms.
23872065 2013 miR-122 targets NOD2 to decrease intestinal epithelial cell injury in Crohn's disease.
23868940 2013 NOD2-mediated innate immune signaling regulates the eicosanoids in atherosclerosis.
23850724 2013 Evidence of expression variation and allelic imbalance in Crohn's disease susceptibility genes NOD2 and ATG16L1 in human dendritic cells.
23824692 2014 Polymorphisms of Helicobacter pylori signaling pathway genes and gastric cancer risk in the European Prospective Investigation into Cancer-Eurgast cohort.
23818254 2013 Disease-causing mutations in the XIAP BIR2 domain impair NOD2-dependent immune signalling.
23806334 2013 OTULIN restricts Met1-linked ubiquitination to control innate immune signaling.
23740944 2013 NOD1 and NOD2 regulate proinflammatory and prolabor mediators in human fetal membranes and myometrium via nuclear factor-kappa B.
23712977 2013 The effects of NOD activation on adipocyte differentiation.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23709157 2013 NOD2 mutations affect muramyl dipeptide stimulation of human B lymphocytes and interact with other IBD-associated genes.
23651603 2013 P268S in NOD2 associates with susceptibility to Parkinson's disease in Chinese population.
23615072 Extended haplotype association study in Crohn's disease identifies a novel, Ashkenazi Jewish-specific missense mutation in the NF-?B pathway gene, HEATR3.
23594678 2013 NOD2 promotes renal injury by exacerbating inflammation and podocyte insulin resistance in diabetic nephropathy.
23562557 2013 NOD2 mutations are associated with the development of intestinal failure in the absence of Crohn's disease.
23558906 2013 Impact of NOD2 polymorphisms on infectious complications following chemotherapy in patients with acute myeloid leukaemia.
23493074 2013 The effect of NOD2 polymorphism on postsurgical recurrence in Crohn's disease: a systematic review and meta-analysis of available literature.
23488593 2014 Hidradenitis suppurativa not associated with CARD15/NOD2 mutation: a case series.
23437331 2013 p62/SQSTM1 enhances NOD2-mediated signaling and cytokine production through stabilizing NOD2 oligomerization.
23409731 2013 NOD2/CARD15 mutations in Turkish patients with ankylosing spondylitis.
23376921 2013 TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3.
23322906 2013 A genome-wide siRNA screen reveals positive and negative regulators of the NOD2 and NF-?B signaling pathways.
23300079 2013 Ubiquitin regulates caspase recruitment domain-mediated signaling by nucleotide-binding oligomerization domain-containing proteins NOD1 and NOD2.
23287275 2013 NLRP1 and NLRP3 inflammasomes are essential for distinct outcomes of decreased cytokines but enhanced bacterial killing upon chronic Nod2 stimulation.
23173613 2013 Nucleotide oligomerization domain 2 polymorphisms in patients with intestinal failure.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23121969 Regulation of Salmonella flagellin-induced interleukin-8 in intestinal epithelial cells by muramyl dipeptide.
23109427 2013 A discrete ubiquitin-mediated network regulates the strength of NOD2 signaling.
23102769 2013 Dermatitis as a characteristic phenotype of a new autoinflammatory disease associated with NOD2 mutations.
23100559 2013 Association of a NOD2 gene polymorphism and T-helper 17 cells with presumed ocular toxoplasmosis.
23085276 2013 NOD2 gene mutations associate weakly with ulcerative colitis but not with Crohn's disease in Indian patients with inflammatory bowel disease.
23019338 2012 Proteasomal degradation of Nod2 protein mediates tolerance to bacterial cell wall components.
22998942 2012 A role for TLR1, TLR2 and NOD2 in cytokine induction by Bacteroides fragilis.
22997500 2012 NOD2 agonist promotes the production of inflammatory cytokines in VSMC in synergy with TLR2 and TLR4 agonists.
22936669 2013 A genome-wide association study on a southern European population identifies a new Crohn's disease susceptibility locus at RBX1-EP300.
22879519 2013 The NOD2insC polymorphism is associated with worse outcome following ileal pouch-anal anastomosis for ulcerative colitis.
22829933 2012 TRIM27 negatively regulates NOD2 by ubiquitination and proteasomal degradation.
22815893 2012 The inositol phosphatase SHIP-1 inhibits NOD2-induced NF-?B activation by disturbing the interaction of XIAP with RIP2.
22807259 2012 No association between NOD2 variants and Parkinson's disease.
22795647 2013 TLR8 and NOD signaling synergistically induce the production of IL-1? and IL-23 in monocyte-derived DCs and enhance the expression of the feedback inhibitor SOCS2.
22739221 2013 Perianal disease combined with NOD2 genotype predicts need for IBD-related surgery in Crohn's disease patients from a population-based cohort.
22730064 2012 Respiratory syncytial virus infection augments NOD2 signaling in an IFN-?-dependent manner in human primary cells.
22719818 2012 Inflammatory bowel diseases phenotype, C. difficile and NOD2 genotype are associated with shifts in human ileum associated microbial composition.
22700971 2012 The c-Jun N-terminal kinase (JNK)-binding protein (JNKBP1) acts as a negative regulator of NOD2 protein signaling by inhibiting its oligomerization process.
22684479 2013 The intermediate filament protein, vimentin, is a regulator of NOD2 activity.
22665475 2012 A dual role for receptor-interacting protein kinase 2 (RIP2) kinase activity in nucleotide-binding oligomerization domain 2 (NOD2)-dependent autophagy.
22605977 2012 CARD15/NOD2, CD14 and toll-like 4 receptor gene polymorphisms in Saudi patients with Crohn's Disease.
22571967 2012 CARD15 and Toll-like receptor 4 mutations in Italian patients with inflammatory bowel disease.
22563200 2012 Association of NOD1 and NOD2 genes polymorphisms with Helicobacter pylori related gastric cancer in a Chinese population.
22549783 2012 Pathogen sensing by nucleotide-binding oligomerization domain-containing protein 2 (NOD2) is mediated by direct binding to muramyl dipeptide and ATP.
22509093 2012 NOD2/CARD15 gene mutation identified in a Chinese family with Blau syndrome.
22504414 2012 Association between C13ORF31, NOD2, RIPK2 and TLR10 polymorphisms and urothelial bladder cancer.
22502597 2012 A novel single nucleotide polymorphism within the NOD2 gene is associated with pulmonary tuberculosis in the Chinese Han, Uygur and Kazak populations.
22464675 2012 Morphologic and immunohistochemical characterization of granulomas in the nucleotide oligomerization domain 2-related disorders Blau syndrome and Crohn disease.
22426692 2012 Confirmation of three inflammatory bowel disease susceptibility loci in a Chinese cohort.
22416979 2012 A case-only study of gene-environment interaction between genetic susceptibility variants in NOD2 and cigarette smoking in Crohn's disease aetiology.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22397822 2012 Immuno-inhibitory PD-L1 can be induced by a peptidoglycan/NOD2 mediated pathway in primary monocytic cells and is deficient in Crohn's patients with homozygous NOD2 mutations.
22346247 2012 Role of ATG16L, NOD2 and IL23R in Crohn's disease pathogenesis.
22319155 2012 Crohn's disease risk alleles on the NOD2 locus have been maintained by natural selection on standing variation.
22289211 2012 Absence of nucleotide-binding oligomerization domain-containing protein 2 variants in patients with leprosy and tuberculosis.
22286692 2012 MIP-3? expression in macrophages is NOD dependent.
22275320 2012 Pattern recognition receptor and autophagy gene variants are associated with development of antimicrobial antibodies in Crohn's disease.
22266421 2012 Non-association of Crohn's disease with NOD2 gene variants in Moroccan patients.
22244368 2012 NOD2/CARD15 gene mutations in patients with familial Mediterranean fever.
22218461 2012 NOD1 and NOD2 stimulation triggers innate immune responses of human periodontal ligament cells.
22212192 2012 Polymorphisms of NOD2 and the risk of tuberculosis: a validation study in the Chinese population.
22147245 2012 NOD2 polymorphism predicts response to treatment in Crohn's disease--first steps to a personalized therapy.
22139875 2011 NOD2 sequencing in Iranian children with Crohn's disease.
21978001 2011 NOD-like receptors and RIG-I-like receptors in human eosinophils: activation by NOD1 and NOD2 agonists.
21943069 2012 A NOD2 gene polymorphism is associated with the prevalence and severity of chronic obstructive pulmonary disease in a Japanese population.
21914217 2011 A new category of autoinflammatory disease associated with NOD2 gene mutations.
21887730 2012 Control of NOD2 and Rip2-dependent innate immune activation by GEF-H1.
21799103 2011 NOD2/CARD15 gene polymorphisms affect outcome in pediatric allogeneic stem cell transplantation.
21768114 2011 Cooperative regulation of NOTCH1 protein-phosphatidylinositol 3-kinase (PI3K) signaling by NOD1, NOD2, and TLR2 receptors renders enhanced refractoriness to transforming growth factor-beta (TGF-beta)- or cytotoxic T-lymphocyte antigen 4 (CTLA-4)-mediated impairment of human dendritic cell maturation.
21745515 2011 Role of NOD1/CARD4 and NOD2/CARD15 gene polymorphisms in cancer etiology.
21745302 2012 NOD2 gene variants are a risk factor for culture-positive spontaneous bacterial peritonitis and monomicrobial bacterascites in cirrhosis.
21744420 2011 Antimicrobial peptide response to blood translocation of bacterial DNA in Crohn's disease is affected by NOD2/CARD15 genotype.
21739538 2012 Variants of NOD1 and NOD2 genes display opposite associations with familial risk of Crohn's disease and anti-saccharomyces cerevisiae antibody levels.
21734790 2011 NOD2 and ATG16L1 polymorphisms affect monocyte responses in Crohn's disease.
21734346 2011 High-resolution melting curve analysis for high-throughput genotyping of NOD2/CARD15 mutations and distribution of these mutations in Slovenian inflammatory bowel diseases patients.
21730793 2011 Influence of Crohn's disease risk alleles and smoking on disease location.
21716313 2011 Association of Toll-like receptor 10 and susceptibility to Crohn's disease independent of NOD2.
21699783 2011 TLE1 modifies the effects of NOD2 in the pathogenesis of Crohn's disease.
21690088 2011 Retinoic acid-induced gene-I (RIG-I) associates with nucleotide-binding oligomerization domain-2 (NOD2) to negatively regulate inflammatory signaling.
21665963 2011 Organic dust augments nucleotide-binding oligomerization domain expression via an NF-{kappa}B pathway to negatively regulate inflammatory responses.
21659536 2011 Distinct roles for Nod2 protein and autocrine interleukin-1beta in muramyl dipeptide-induced mitogen-activated protein kinase activation and cytokine secretion in human macrophages.
21625457 2011 Variation in NOD2 augments Th2- and Th17 responses to myelin basic protein in multiple sclerosis.
21596301 2011 Uveitis in Blau syndrome from a de novo mutation of the NOD2/CARD15 gene.
21573891 2011 Association analysis of the NOD2 gene with susceptibility to graft-versus-host disease in a Japanese population.
21565239 2011 Association between NOD2/CARD15 polymorphisms and coronary artery disease: a case-control study.
21460759 2012 Importance of NOD2/CARD15 gene variants for susceptibility to and outcome of sepsis in Turkish children.
21448648 2012 Meta-analysis of NOD2/CARD15 polymorphisms with psoriasis and psoriatic arthritis.
21410503 2011 Functional expression of NOD2 in freshly isolated human peripheral blood ?? T cells.
21391291 2011 Combination of genetic and quantitative serological immune markers are associated with complicated Crohn's disease behavior.
21388357 2011 Caspase recruitment domain 15 gene haplotypes in sarcoidosis.
21385537 MEFV, TNFRSF1A and CARD15 mutation analysis in Behçet's disease.
21343918 2011 The prognostic power of the NOD2 genotype for complicated Crohn's disease: a meta-analysis.
21342182 2011 Nucleotide-binding and oligomerization domain-like receptors and retinoic acid inducible gene-like receptors in human tonsillar T lymphocytes.
21337670 2011 Are NOD2 polymorphisms linked to a specific disease endophenotype of Crohn's disease?
21335489 2011 Genome-wide expression profiling identifies an impairment of negative feedback signals in the Crohn's disease-associated NOD2 variant L1007fsinsC.
21310790 2012 Mutational analysis of human NOD1 and NOD2 NACHT domains reveals different modes of activation.
21274544 2011 NOD2 exonic variations in Iranian Crohn's disease patients.
21263023 2011 NOD-like receptor activation by outer membrane vesicles from Vibrio cholerae non-O1 non-O139 strains is modulated by the quorum-sensing regulator HapR.
21241317 2011 NOD-like receptors in the human upper airways: a potential role in nasal polyposis.
21218092 2011 Risk factors and gene polymorphisms of inflammatory bowel disease in population of Zhejiang, China.
21215810 2011 NOD2/CARD15 variants are not a risk factor for clinical outcome after nonmyeloablative allogeneic stem cell transplantation.
21209938 2010 The NOD2 single nucleotide polymorphisms rs2066843 and rs2076756 are novel and common Crohn's disease susceptibility gene variants.
21206965 2011 IL23R, NOD2/CARD15, ATG16L1 and PHOX2B polymorphisms in a group of patients with Crohn's disease and correlation with sub-phenotypes.
21172192 2007 NOD2 activity modulates the phenotype of LPS-stimulated dendritic cells to promote the development of T-helper type 2-like lymphocytes - Possible implications for NOD2-associated Crohn's disease.
21155887 2011 Common variants in NOD2 and IL23R are not associated with inflammatory bowel disease in Indians.
21123652 2010 Inhibition of RIP2's tyrosine kinase activity limits NOD2-driven cytokine responses.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21097508 2011 A novel motif in the Crohn's disease susceptibility protein, NOD2, allows TRAF4 to down-regulate innate immune responses.
21042538 2010 Implication of NOD1 and NOD2 for the differentiation of multipotent mesenchymal stem cells derived from human umbilical cord blood.
21040358 2011 NOD2 controls the nature of the inflammatory response and subsequent fate of Mycobacterium tuberculosis and M. bovis BCG in human macrophages.
21040192 2010 Lack of common NOD2 mutations in Korean pediatric patients with inflammatory bowel disease.
21039068 2010 NOD2, CD14 and TLR4 mutations do not influence response to adalimumab in patients with Crohn's disease: a preliminary report.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20959815 2011 NOD2 gene polymorphism rs2066844 associates with need for combined liver-intestine transplantation in children with short-gut syndrome.
20940596 2010 NOD2/CARD15 mutations correlate with severe pouchitis after ileal pouch-anal anastomosis.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20875485 2010 Crohn's disease susceptibility gene interactions, a NOD to the newcomer ATG16L1.
20865702 2011 Serum lipopolysaccharide-binding protein and soluble CD14 are markers of disease activity in patients with Crohn's disease.
20854823 2011 Secretory mediators regulate Nod2-induced tolerance in human macrophages.
20850627 2010 Hirschsprung-associated enterocolitis develops independently of NOD2 variants.
20844241 2011 Effects of NOD-like receptors in human B lymphocytes and crosstalk between NOD1/NOD2 and Toll-like receptors.
20839241 2011 Disease phenotype and genotype are associated with shifts in intestinal-associated microbiota in inflammatory bowel diseases.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20713205 2010 NOD2 mutations predict the risk for surgery in pediatric-onset Crohn's disease.
20698950 2010 NOD2-C2 - a novel NOD2 isoform activating NF-kappaB in a muramyl dipeptide-independent manner.
20676658 2010 CARD15 mutations and colorectal cancer in a South European country.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20646321 2010 Toll-like receptor (TLR) and nucleosome-binding oligomerization domain (NOD) gene polymorphisms and endometrial cancer risk.
20646002 2010 NOD2 polymorphisms in clinical phenotypes of common variable immunodeficiency disorders.
20637199 2010 ATG16L1 and NOD2 interact in an autophagy-dependent antibacterial pathway implicated in Crohn's disease pathogenesis.
20632099 2011 CARD15 mutations and perianal fistulating Crohn's disease: correlation and predictive value of antibiotic response.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622911 2011 Toll-like receptor 9, NOD2 and IL23R gene polymorphisms influenced outcome in AML patients transplanted from HLA-identical sibling donors.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
20595247 2010 Polymorphisms of innate pattern recognition receptors, response to interferon-beta and development of neutralizing antibodies in multiple sclerosis patients.
20583427 Three common CARD15 mutations are not responsible for the pathogenesis of Crohn's disease in Iranians.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20565245 2010 Familial case of Blau syndrome associated with a CARD15/NOD2 mutation.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20541026 2010 Genetic variations of interleukin-23R (1143A>G) and BPI (A645G), but not of NOD2, are associated with acute graft-versus-host disease after allogeneic transplantation.
20537165 2010 The CTLA4 variants may interact with the IL23R- and NOD2-conferred risk in development of Crohn's disease.
20525885 2010 TLR2- and nucleotide-binding oligomerization domain 2-dependent Krüppel-like factor 2 expression downregulates NF-kappa B-related gene expression.
20524760 2010 NOD2/CARD15: geographic differences in the Spanish population and clinical applications in Crohn's disease.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485703 2010 Replication and meta-analysis of 13,000 cases defines the risk for interleukin-23 receptor and autophagy-related 16-like 1 variants in Crohn's disease.
20483763 2010 The pathogen recognition receptor NOD2 regulates human FOXP3+ T cell survival.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20441518 2010 Recognition of Borrelia burgdorferi by NOD2 is central for the induction of an inflammatory reaction.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20436512 2010 Functional characterization of the NF-kappaB binding site in the human NOD2 promoter.
20428899 2010 The presence of fistulas and NOD2 homozygosity strongly predict intestinal stenosis in Crohn's disease independent of the IL23R genotype.
20412372 2010 NOD2/CARD15 genotype, cardiovascular disease and cancer in 43,600 individuals from the general population.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20387682 2010 [Crohn's disease: genetic aspects].
20385562 2010 Caspase recruitment domain-containing protein 8 (CARD8) negatively regulates NOD2-mediated signaling.
20384614 2010 Nod1, Nod2 and Nalp3 receptors, new potential targets in treatment of allergic rhinitis?
20380008 2010 NOD2/CARD15, ATG16L1 and IL23R gene polymorphisms and childhood-onset of Crohn's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20373538 2010 Clinical periodontal and microbiologic parameters in patients with Crohn's disease with consideration of the CARD15 genotype.
20371648 2010 Penetrance of NOD2/CARD15 genetic variants in the general population.
20362271 2010 Robust replication of genotype-phenotype associations across multiple diseases in an electronic medical record.
20350193 2010 Common polymorphisms in the NOD2 gene region are associated with leprosy and its reactive states.
20346235 Possible association between NOD2 variants and joint surgery in psoriatic arthritis.
20332463 2010 TLR4 and NOD2/CARD15 genetic polymorphisms and their possible role in gastric carcinogenesis.
20298285 2007 Blau syndrome-associated mutations in exon 4 of the caspase activating recruitment domain 15 (CARD 15) gene are not found in ethnic Danes with sarcoidosis.
20232407 2010 Association of the NOD2 genotype with bacterial translocation via altered cell-cell contacts in Crohn's disease patients.
20230816 2010 Association of c.802C>T polymorphism of NOD2/CARD15 gene with the chronic gastritis and predisposition to cancer in H. pylori infected patients.
20199415 Sporadic Blau syndrome with onset of widespread granulomatous dermatitis in the newborn period.
20182871 2010 Is there a role for mannan-binding lectin in the diagnosis of inflammatory bowel disease?
20177049 2010 Insufficient evidence for association of NOD2/CARD15 or other inflammatory bowel disease-associated markers on GVHD incidence or other adverse outcomes in T-replete, unrelated donor transplantation.
20155851 2010 NOD2 status and human ileal gene expression.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20124104 2010 Nod1 and nod2 are expressed in human and murine renal tubular epithelial cells and participate in renal ischemia reperfusion injury.
20110711 2010 Genotypic interaction and gender specificity of common genetic variants in the p53/mdm2 network in Crohn's disease.
20087966 2010 Nucleotide-binding oligomerization domain containing 2 (NOD2) variants are genetic risk factors for death and spontaneous bacterial peritonitis in liver cirrhosis.
20082483 2010 NOD2, IL23R and ATG16L1 polymorphisms in Lithuanian patients with inflammatory bowel disease.
20079790 2010 Mannose-binding lectin level and deficiency is not associated with inflammatory bowel diseases, disease phenotype, serology profile, and NOD2/CARD15 genotype in a large Hungarian cohort.
20066736 2010 Interaction of the major inflammatory bowel disease susceptibility alleles in Crohn's disease patients.
20047977 2010 Tumor necrosis factor (TNF) and lymphotoxin-alpha (LTA) polymorphisms and risk of non-Hodgkin lymphoma in the InterLymph Consortium.
20032092 2010 Genetic susceptibility factors in a cohort of 38 patients with SAPHO syndrome: a study of PSTPIP2, NOD2, and LPIN2 genes.
20027650 2010 Combination of innate and adaptive immune alterations increased the likelihood of fibrostenosis in Crohn's disease.
20024904 2010 Variants at the 3p21 locus influence susceptibility and phenotype both in adults and early-onset patients with inflammatory bowel disease.
20018961 2009 Genomewide association study of leprosy.
20002790 2010 The expression and function of Nod-like receptors in neutrophils.
19966812 2010 NOD2 stimulation induces autophagy in dendritic cells influencing bacterial handling and antigen presentation.
19948723 2010 Direct and indirect induction by 1,25-dihydroxyvitamin D3 of the NOD2/CARD15-defensin beta2 innate immune pathway defective in Crohn disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912254 2010 Recipient NOD2/CARD15 status affects cellular infiltrates in human intestinal graft-versus-host disease.
19907652 2009 Evidence for impaired CARD15 signalling in Crohn's disease without disease linked variants.
19898471 2010 Nod1 and Nod2 direct autophagy by recruiting ATG16L1 to the plasma membrane at the site of bacterial entry.
19896081 2009 Polymorphism of interleukin-23 receptor gene but not of NOD2/CARD15 is associated with graft-versus-host disease after hematopoietic stem cell transplantation in children.
19888426 2009 Analysis of candidate genes in occurrence and growth of colorectal adenomas.
19880660 2011 Expression of NOD2 is increased in inflamed human dental pulps and lipoteichoic acid-stimulated odontoblast-like cells.
19853919 2009 Nucleotide oligomerization domain-2 interacts with 2'-5'-oligoadenylate synthetase type 2 and enhances RNase-L function in THP-1 cells.
19843337 2009 Investigation of innate immunity genes CARD4, CARD8 and CARD15 as germline susceptibility factors for colorectal cancer.
19830732 2009 Butyrate mediates nucleotide-binding and oligomerisation domain (NOD) 2-dependent mucosal immune responses against peptidoglycan.
19826411 2010 NOD2 mutations and anti-Saccharomyces cerevisiae antibodies are risk factors for Crohn's disease in African Americans.
19822951 2009 Blau syndrome-related CARD15/NOD2 mutations are not linked to idiopathic uveitis in Spanish patients.
19809335 2010 Toll-like receptor 4 gene polymorphism modulates phenotypic expression in patients with hereditary hemochromatosis.
19787357 2010 Differential effects of NOD2 polymorphisms on colorectal cancer risk: a meta-analysis.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19759286 2009 DUOX2-derived reactive oxygen species are effectors of NOD2-mediated antibacterial responses.
19748964 2009 Low prevalence of NOD2 SNPs in Behçet's disease suggests protective association in Caucasians.
19728064 2009 Nod2 mutation enhances NF-kappa B activity and bacterial killing activity of macrophages.
19721713 2009 Caspase-12 and the inflammatory response to Yersinia pestis.
19713276 2009 Genotyping for NOD2 genetic variants and crohn disease: a metaanalysis.
19701969 2009 Anti-microbial antibodies in celiac disease: trick or treat?
19701189 2009 Activation of innate immune antiviral responses by Nod2.
19693669 2010 Response to medical treatment in patients with Crohn's disease: the role of NOD2/CRAD15, disease phenotype, and age of diagnosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19679608 2010 CARD15/NOD2 polymorphisms are associated with severe pulmonary sarcoidosis.
19679065 2009 Clinical characteristics of tumors derived from colorectal cancer patients who harbor the tumor necrosis factor alpha-1031T/T and NOD2 3020insC polymorphism.
19667203 2009 XIAP mediates NOD signaling via interaction with RIP2.
19664207 2009 Tolllike receptor 4 (TLR4) polymorphisms in Tunisian patients with Crohn's disease: genotype-phenotype correlation.
19659808 2009 Autophagy 16-like 1 rs2241880 G allele is associated with Crohn's disease in German children.
19641059 2009 First description of NOD2 variant associated with defective neutrophil responses in a woman with granulomatous mastitis related to corynebacteria.
19638967 2009 CARD15 gene variants and risk of reoperation in Crohn's disease patients.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19592251 2009 ITCH K63-ubiquitinates the NOD2 binding protein, RIP2, to influence inflammatory signaling pathways.
19590455 2009 Association of IL23R p.381Gln and ATG16L1 p.197Ala with Crohn disease in the Czech population.
19579029 2010 Association of chronic non-bacterial osteomyelitis with Crohn's disease but not with CARD15 gene variants.
19579027 2010 MEFV, TNF1rA, CARD15 and NLRP3 mutation analysis in PFAPA.
19572373 2009 MDP-Induced selective tolerance to TLR4 ligands: impairment in NOD2 mutant Crohn's disease patients.
19570976 2009 pH-dependent internalization of muramyl peptides from early endosomes enables Nod1 and Nod2 signaling.
19570052 2010 NOD2/CARD15 genotype and common gastrointestinal diseases in 43,600 individuals.
19535145 2009 A function for AAMP in Nod2-mediated NF-kappaB activation.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19482182 2009 Expression of nucleotide-binding oligomerization domain 2 in normal human dental pulp cells and dental pulp tissues.
19479837 2009 NOD2-associated pediatric granulomatous arthritis, an expanding phenotype: study of an international registry and a national cohort in Spain.
19479836 2009 Incomplete penetrance of the NOD2 E383K substitution among members of a pediatric granulomatous arthritis pedigree.
19434699 2009 Colonic lymphoid follicles and NOD2/CARD15 mutational status in Crohn's disease.
19426395 2009 Identification of NOD2/CARD15 mutations in Malaysian patients with Crohn's disease.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19406482 2009 Functional expression of pattern recognition receptors in tissues of the human female reproductive tract.
19397946 2009 NOD2/CARD15 polymorphisms impair innate immunity and increase susceptibility to gastric cancer in an Italian population.
19359344 2009 Cardiac infiltration in early-onset sarcoidosis associated with a novel heterozygous mutation, G481D, in CARD15.
19349988 2009 A Crohn's disease-associated NOD2 mutation suppresses transcription of human IL10 by inhibiting activity of the nuclear ribonucleoprotein hnRNP-A1.
19337385 2009 Evaluation of Nod-like receptor (NLR) effector domain interactions.
19337309 2009 Specific association of a CLEC16A/KIAA0350 polymorphism with NOD2/CARD15(-) Crohn's disease patients.
19319132 2009 Combined polymorphisms in genes encoding the inflammasome components NALP3 and CARD8 confer susceptibility to Crohn's disease in Swedish men.
19305026 [Parenteral symptoms and intestinal complications in children with inflammatory bowel diseases in relation to card15 mutation].
19299732 2009 Clathrin- and dynamin-dependent endocytic pathway regulates muramyl dipeptide internalization and NOD2 activation.
19275920 2009 Interactions among genes influencing bacterial recognition increase IBD risk in a population-based New Zealand cohort.
19273470 2009 Differential expression and regulation of nuclear oligomerization domain proteins NOD1 and NOD2 in human endometrium: a potential role in innate immune protection and menstruation.
19266573 2009 Activation of NOD2-mediated intestinal pathway in a pediatric population with Crohn's disease.
19262523 2009 rs224136 on chromosome 10q21.1 and variants in PHOX2B, NCF4, and FAM92B are not major genetic risk factors for susceptibility to Crohn's disease in the German population.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19253375 2009 Phenotypic associations of Crohn's disease with antibodies to flagellins A4-Fla2 and Fla-X, ASCA, p-ANCA, PAB, and NOD2 mutations in a Swiss Cohort.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19244164 2009 NOD2/CARD15 on bone marrow CD34+ hematopoietic cells mediates induction of cytokines and cell differentiation.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19235913 2009 Association between genetic variants in myosin IXB and Crohn's disease.
19219079 2009 NOD2 polymorphisms predict severe acute graft-versus-host and treatment-related mortality in T-cell-depleted haematopoietic stem cell transplantation.
19200604 2009 Gene polymorphisms of Toll-like and related recognition receptors in relation to the vaginal carriage of Gardnerella vaginalis and Atopobium vaginae.
19189651 Association of polymorphisms of NOD2, TLR4 and CD14 genes with susceptibility to gastric mucosa-associated lymphoid tissue lymphoma.
19184350 2009 3020insC insertion in NOD2/CARD15 gene, a prevalent variant associated with anti-Saccharomyces cerevisiae antibodies and ileal location of Crohn's disease in Tunisian population.
19184348 2009 Interleukin 10 promoter region polymorphisms in inflammatory bowel disease in Tunisian population.
19183163 2009 Infliximab dependency in children with Crohn's disease.
19174806 2009 TNFSF15 polymorphisms are associated with susceptibility to inflammatory bowel disease in a new European cohort.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169908 A novel mutation in the NOD2 gene associated with Blau syndrome: a Norwegian family with four affected members.
19139201 2009 Critical role of NOD2 in regulating the immune response to Staphylococcus aureus.
19120480 2009 Function of Nod-like receptors in microbial recognition and host defense.
19116920 2009 Role of the NOD2 genotype in the clinical phenotype of Blau syndrome and early-onset sarcoidosis.
19112191 Common NOD2 mutations are absent in patients with Crohn's disease in India.
19103559 2009 [Susceptibility genetic variants in Hungarian morbus Crohn and ulcerative colitis patients].
19103524 2008 NOD2 engagement induces proinflammatory cytokine production, but not apoptosis, in leukocytes isolated from patients with Crohn's disease.
19098858 2009 Polymorphism of the IRGM gene might predispose to fistulizing behavior in Crohn's disease.
19079230 2008 The molecular basis of NOD2 susceptibility mutations in Crohn's disease.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19058231 2009 Absence of mycobacterium avium subsp. paratuberculosis in Crohn's patients.
19050632 2009 Polymorphisms in innate immunity genes predispose to bacteremia and death in the medical intensive care unit.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18985712 2009 Autophagy gene ATG16L1 but not IRGM is associated with Crohn's disease in Canadian children.
18976442 2008 The role of genetic variants of NOD2/CARD15, a receptor of the innate immune system, in GvHD and complications following related and unrelated donor haematopoietic stem cell transplantation.
18972554 2009 Pancreatic autoantibodies are associated with reactivity to microbial antibodies, penetrating disease behavior, perianal disease, and extraintestinal manifestations, but not with NOD2/CARD15 or TLR4 genotype in a Hungarian IBD cohort.
18942754 2009 Immune response and gene polymorphism profiles in Crohn's disease and ulcerative colitis.
18942751 2009 High-frequency haplotypes in the X chromosome locus TLR8 are associated with both CD and UC in females.
18938111 2009 Hyperexpression of NOD2 in intestinal mast cells of Crohn's disease patients: preferential expression of inflammatory cell-recruiting molecules via NOD2 in mast cells.
18855982 2008 Evidence for the involvement of NOD2 in regulating colonic epithelial cell growth and survival.
18824555 2009 Molecular prediction of disease risk and severity in a large Dutch Crohn's disease cohort.
18819462 2008 The 3020insC NOD2 gene mutation in patients with ovarian cancer.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18804983 2009 Association of genetic profiles to Crohn's disease by linear combinations of single nucleotide polymorphisms.
18787464 2008 CARD15 gene polymorphisms in Serbian patients with Crohn's disease: genotype-phenotype analysis.
18758464 2008 Loci on 20q13 and 21q22 are associated with pediatric-onset inflammatory bowel disease.
18758419 2008 NOD2/CARD15 polymorphism in patients with rectal cancer.
18756601 2008 OCTN and CARD15 gene polymorphism in Chinese patients with inflammatory bowel disease.
18715515 2008 Lack of evidence for association of primary sclerosing cholangitis and primary biliary cirrhosis with risk alleles for Crohn's disease in Polish patients.
18698678 2008 Replication of interleukin 23 receptor and autophagy-related 16-like 1 association in adult- and pediatric-onset inflammatory bowel disease in Italy.
18680223 2008 Clinical significance of NOD2/CARD15 and Toll-like receptor 4 gene single nucleotide polymorphisms in inflammatory bowel disease.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18670786 2009 Clustering of (auto)immune diseases with early-onset and complicated inflammatory bowel disease.
18647548 2008 Frequency of representative single nucleotide polymorphisms associated with inflammatory bowel disease in the Czech Republic and Slovak Republic.
18640012 2008 Common NOD2 mutations are rare in patients with inverse acne.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18619921 2008 Increased immune reactivity predicts aggressive complicating Crohn's disease in children.
18617779 2008 The V249I polymorphism of the CX3CR1 gene is associated with fibrostenotic disease behavior in patients with Crohn's disease.
18594982 2009 Disease behavior in children with Crohn's disease: the effect of disease duration, ethnicity, genotype, and phenotype.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18576390 2008 Autoinflammatory genes and susceptibility to psoriatic juvenile idiopathic arthritis.
18574154 2008 Differential function of the NACHT-LRR (NLR) members Nod1 and Nod2 in arthritis.
18573991 2008 Synergism between TLRs and NOD1/2 in oral epithelial cells.
18563169 2008 Detailed assessment of NOD2/CARD15 exonic variation in inflammatory bowel disease in Scotland: implications for disease pathogenesis.
18541930 Frequency of three common mutations of CARD15/NOD2 gene in Iranian IBD patients.
18521924 2008 Clinical and molecular characteristics of isolated colonic Crohn's disease.
18521914 2008 Contributions of IBD5, IL23R, ATG16L1, and NOD2 to Crohn's disease risk in a population-based case-control study: evidence of gene-gene interactions.
18511561 2008 A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide.
18507017 Gene polymorphisms of the NOD-2/CARD-15 gene and the risk of gastric cancer in Germany.
18489434 2008 Variants of CARD15, TNFA and PTPN22 and susceptibility to Crohn's disease in the Czech population: high frequency of the CARD15 1007fs.
18466472 2007 Constructing gene association networks for rheumatoid arthritis using the backward genotype-trait association (BGTA) algorithm.
18438406 2008 Genetic determinants of ulcerative colitis include the ECM1 locus and five loci implicated in Crohn's disease.
18433468 2008 Inflammatory response gene polymorphisms and their relationship with colorectal cancer risk.
18419343 2008 Common nonsynonymous polymorphisms in the NOD2 gene are associated with resistance or susceptibility to tuberculosis disease in African Americans.
18413660 2008 Inhibition of Nod2 signaling and target gene expression by curcumin.
18384487 2008 Mutation screening of the CARD15 gene in sarcoidosis.
18383179 2008 NOD2/CARD15 genotype influences MDP-induced cytokine release and basal IL-12p40 levels in primary isolated peripheral blood monocytes.
18382655 2008 Maternal TLR4 and NOD2 gene variants, pro-inflammatory phenotype and susceptibility to early-onset preeclampsia and HELLP syndrome.
18371140 2008 NOD2/CARD15 gene variants are linked to failure of antibiotic treatment in perianal fistulating Crohn's disease.
18371139 2008 Incidence of Mycobacterium avium subspecies paratuberculosis in a population-based cohort of patients with Crohn's disease and control subjects.
18367950 2008 Frequency and clinical correlations of granulomas in children with Crohn disease.
18341489 2008 The role of CARD15 mutations and smoking in the course of Crohn's disease in a Mediterranean area.
18340358 2008 The effect of NOD2 activation on TLR2-mediated cytokine responses is dependent on activation dose and NOD2 genotype.
18317454 2008 No impact of NOD2/CARD15 on outcome after SCT.
18305068 2008 Reduced alpha-defensin expression is associated with inflammation and not NOD2 mutation status in ileal Crohn's disease.
18271063 2008 Interleukin-1B (IL1B) and interleukin-6 (IL6) gene polymorphisms are associated with risk of chronic lymphocytic leukaemia.
18256385 2008 A role for membrane-bound CD147 in NOD2-mediated recognition of bacterial cytoinvasion.
18253730 2008 Evolution of Crohn's disease-associated Nod2 mutations.
18248772 2008 Genotype-phenotype analysis of the CXCL16 p.Ala181Val polymorphism in inflammatory bowel disease.
18243161 2008 The phosphatidylinositol 3-kinase/Akt pathway negatively regulates Nod2-mediated NF-kappaB pathway.
18240302 2008 Monocyte-derived dendritic cells from Crohn patients show differential NOD2/CARD15-dependent immune responses to bacteria.
18227809 2008 NOD2: a potential target for regulating liver injury.
18219096 2008 Analysis of Crohn's disease-related CARD15 polymorphisms in Spanish patients with idiopathic uveitis.
18213697 2008 Novel NOD2 haplotype strengthens the association between TLR4 Asp299gly and Crohn's disease in an Australian population.
18200510 2008 CARD15 and IL23R influences Crohn's disease susceptibility but not disease phenotype in a Brazilian population.
18200509 2008 Two-stage candidate gene study of chromosome 3p demonstrates an association between nonsynonymous variants in the MST1R gene and Crohn's disease.
18184136 2008 Prevalence of CARD15/NOD2 mutations in the Sicilian population.
18182678 2008 NOD2/CARD15 polymorphisms in allogeneic stem-cell transplantation from unrelated donors: T depletion matters.
18166373 2008 ATG16L1 Ala197Thr is not associated with susceptibility to Crohn's disease or with phenotype in an Italian population.
18162085 2008 The ATG16L1 gene variants rs2241879 and rs2241880 (T300A) are strongly associated with susceptibility to Crohn's disease in the German population.
18158963 2008 Recipient NOD2/CARD15 variants: a novel independent risk factor for the development of bronchiolitis obliterans after allogeneic stem cell transplantation.
18157816 2008 Engagement of NOD2 has a dual effect on proIL-1beta mRNA transcription and secretion of bioactive IL-1beta.
18096043 2007 Functional characterization of two novel 5' untranslated exons reveals a complex regulation of NOD2 protein expression.
18092345 2008 Mucosal NOD2 expression and NF-kappaB activation in pediatric Crohn's disease.
18092344 2008 No association of the CARD8 (TUCAN) c.30T>A (p.C10X) variant with Crohn's disease: a study in 3 independent European cohorts.
18090989 2008 Diverse effects of the CARD15 and IBD5 loci on clinical phenotype in 630 patients with Crohn's disease.
18088053 2008 Autophagy gene ATG16L1 influences susceptibility and disease location but not childhood-onset in Crohn's disease in Northern Europe.
18069758 2007 Heterozygous nucleotide-binding oligomerization domain-2 mutations affect monocyte maturation in Crohn's disease.
18052659 2007 [CARD15 mutations are poorly related to Crohn's disease phenotypes in Asturias].
18047543 2008 New serological markers for inflammatory bowel disease are associated with earlier age at onset, complicated disease behavior, risk for surgery, and NOD2/CARD15 genotype in a Hungarian IBD cohort.
18028374 2008 Crohn's disease patients homozygous for the 3020insC NOD2 mutation have a defective NOD2/TLR4 cross-tolerance to intestinal stimuli.
18022871 2008 GRIM-19 mutations are not associated with Crohn's disease.
18022867 2008 Linking genetic susceptibility to Crohn's disease with Th17 cell function: IL-22 serum levels are increased in Crohn's disease and correlate with disease activity and IL23R genotype status.
17980027 2007 Role of NOD2/CARD15 in coronary heart disease.
17978873 2008 1007fs, G908R, R702W mutations and P268S, IVS8+158 polymorphisms of the CARD15 gene in Turkish inflammatory bowel disease patients and their relationship with disease-related surgery.
17976376 2007 TLR- and NOD2-dependent regulation of human phagocyte-specific chitotriosidase.
17968944 2007 NOD2 gene-associated pediatric granulomatous arthritis: clinical diversity, novel and recurrent mutations, and evidence of clinical improvement with interleukin-1 blockade in a Spanish cohort.
17964870 2007 NOD1 gene E266K polymorphism is associated with disease susceptibility but not with disease phenotype or NOD2/CARD15 in Hungarian patients with Crohn's disease.
17964196 Immunogenetic factors in donors and patients that affect the outcome of hematopoietic stem cell transplantation.
17941079 2008 Novel CARD15/NOD2 mutations in Finnish patients with Crohn's disease and their relation to phenotypic variation in vitro and in vivo.
17919942 2007 Stimulation of the intracellular bacterial sensor NOD2 programs dendritic cells to promote interleukin-17 production in human memory T cells.
17911997 2007 Lack of association between CARD15 gene polymorphisms and hidradenitis suppurativa: a pilot study.
17907287 2007 Influence of a nucleotide oligomerization domain 1 (NOD1) polymorphism and NOD2 mutant alleles on Crohn's disease phenotype.
17894849 2007 IL23R R381Q and ATG16L1 T300A are strongly associated with Crohn's disease in a study of New Zealand Caucasians with inflammatory bowel disease.
17892524 2007 Evidence of allelic heterogeneity for associations between the NOD2/CARD15 gene and ulcerative colitis among North Indians.
17877509 2007 Heterozygosity for IL23R p.Arg381Gln confers a protective effect not only against Crohn's disease but also ulcerative colitis.
17876878 2007 Crohn's disease incidence evolution in North-western Greece is not associated with alteration of NOD2/CARD15 variants.
17852840 2007 Mutations in CARD15 and smoking confer susceptibility to Crohn's disease in the Danish population.
17804789 2007 Genome-wide association study for Crohn's disease in the Quebec Founder Population identifies multiple validated disease loci.
17786191 2007 rs1004819 is the main disease-associated IL23R variant in German Crohn's disease patients: combined analysis of IL23R, CARD15, and OCTN1/2 variants.
17763471 2007 Pediatric onset Crohn's colitis is characterized by genotype-dependent age-related susceptibility.
17725592 2008 Clinical and genetic factors associated with sacroiliitis in Crohn's disease.
17724347 2007 Single nucleotide polymorphisms in the NOD2/CARD15 gene are associated with an increased risk of relapse and death for patients with acute leukemia after hematopoietic stem-cell transplantation with unrelated donors.
17719742 2007 Identification, evolution, and association study of a novel promoter and first exon of the human NOD2 (CARD15) gene.
17705850 2007 The pathogen recognition sensor, NOD2, is variably expressed in patients with pulmonary tuberculosis.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17690884 2007 The Nodosome: Nod1 and Nod2 control bacterial infections and inflammation.
17684544 2007 Systematic association mapping identifies NELL1 as a novel IBD disease gene.
17666747 2007 Polymorphisms within epithelial receptors: NOD2/CARD15.
17661913 2007 The role of the selenoprotein S (SELS) gene -105G>A promoter polymorphism in inflammatory bowel disease and regulation of SELS gene expression in intestinal inflammation.
17660460 2007 Estimating risks of common complex diseases across genetic and environmental factors: the example of Crohn disease.
17652449 2007 Mycobacterium paratuberculosis is recognized by Toll-like receptors and NOD2.
17620097 2007 Polymorphisms in NACHT-LRR (NLR) genes in atopic dermatitis.
17613538 2007 Investigation of NOD1/CARD4 variation in inflammatory bowel disease using a haplotype-tagging strategy.
17600378 2007 Evaluating the role of the genetic variations of PTPN22, NFKB1, and FcGRIIIA genes in inflammatory bowel disease: a meta-analysis.
17595233 2007 Mutations in pattern recognition receptor genes modulate seroreactivity to microbial antigens in patients with inflammatory bowel disease.
17570063 2008 Analysis of the NOD2/CARD15 gene in patients affected with the aseptic abscesses syndrome with or without inflammatory bowel disease.
17565648 2007 Tumor necrosis factor-alpha haplotype is strongly associated with bone mineral density in patients with Crohn's disease.
17563761 2007 Bacterial peptidoglycan breaks down intestinal tolerance via mast cell activation: the role of TLR2 and NOD2.
17558906 2007 Association of interleukin-1 receptor-associated kinase M (IRAK-M) and inflammatory bowel diseases.
17558494 2007 Genetic variants in the NOD2/CARD15 gene are associated with early mortality in sepsis patients.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17548659 2007 Regulation of DMBT1 via NOD2 and TLR4 in intestinal epithelial cells modulates bacterial recognition and invasion.
17538984 2007 Effect of inflammatory bowel disease classification changes on NOD2 genotype-phenotype associations in a population-based cohort.
17509030 2007 Risk factors for perianal Crohn's disease: the role of genotype, phenotype, and ethnicity.
17498224 2007 Impact of NOD2/CARD15 haplotypes on the outcome after kidney transplantation.
17489054 2007 CARD15 mutations in Dutch familial and sporadic inflammatory bowel disease and an overview of European studies.
17486745 2007 Clinical applications of NOD2/CARD15 mutations in Crohn's disease.
17484864 2007 A nonsynonymous SNP in ATG16L1 predisposes to ileal Crohn's disease and is independent of CARD15 and IBD5.
17484863 2007 IL23R variation determines susceptibility but not disease phenotype in inflammatory bowel disease.
17476680 2007 Genetic susceptibility has a more important role in pediatric-onset Crohn's disease than in adult-onset Crohn's disease.
17460484 2007 Functional consequences of NOD2/CARD15 mutations in Crohn disease.
17452051 2007 Antibodies to proteinase 3 prime human monocytic cells via protease-activated receptor-2 and NF-kappaB for Toll-like receptor- and NOD-dependent activation.
17451203 2007 Role of CARD15, DLG5 and OCTN genes polymorphisms in children with inflammatory bowel diseases.
17447842 2007 Novel Crohn disease locus identified by genome-wide association maps to a gene desert on 5p13.1 and modulates expression of PTGER4.
17435756 2007 Genome-wide association study identifies new susceptibility loci for Crohn disease and implicates autophagy in disease pathogenesis.
17417801 2007 Seroreactivity to microbial components in Crohn's disease is associated with ileal involvement, noninflammatory disease behavior and NOD2/CARD15 genotype, but not with risk for surgery in a Hungarian cohort of IBD patients.
17404888 2007 CARD15 genotype-phenotype relationships in a small inflammatory bowel disease population with severe disease affection status.
17403538 2007 Various human epithelial cells express functional Toll-like receptors, NOD1 and NOD2 to produce anti-microbial peptides, but not proinflammatory cytokines.
17393391 2007 Interstitial pneumonitis in Blau syndrome with documented mutation in CARD15.
17389035 2007 Common NOD2/CARD15 variants are not associated with susceptibility or the clinicopathologic characteristics of sporadic colorectal cancer in Hungarian patients.
17389014 2007 Epistatic interaction between FCRL3 and MHC in Spanish patients with IBD.
17379562 2007 How NOD2 mutations predispose to Crohn's disease?
17356065 2007 Modulation of Nod2-dependent NF-kappaB signaling by the actin cytoskeleton.
17355968 2007 The NOD2-RICK complex signals from the plasma membrane.
17351900 2007 No evidence for association of NOD2 R702W and G908R with colorectal cancer.
17337463 2007 IL23R Arg381Gln is associated with childhood onset inflammatory bowel disease in Scotland.
17337451 2007 The subunit CSN6 of the COP9 signalosome is cleaved during apoptosis.
17333217 2007 Lack of association of the 3'-UTR polymorphism in the NFKBIA gene with Crohn's disease in an Israeli cohort.
17319929 2007 Prevalence of CARD15/NOD2 mutations in Caucasian healthy people.
17303577 2007 Differential modulation of Nods signaling pathways by fatty acids in human colonic epithelial HCT116 cells.
17301648 2007 Association of NOD2/CARD15 mutations on Crohn's disease phenotype in an Italian population.
17285593 2007 Contribution of the NOD1/CARD4 insertion/deletion polymorphism +32656 to inflammatory bowel disease in Northern Europe.
17278126 2007 Role of ASCA and the NOD2/CARD15 mutation Gly908Arg in predicting increased surgical costs in Crohn's disease patients: a project of the European Collaborative Study Group on Inflammatory Bowel Disease.
17269998 2007 Combined type-1 plasminogen activator inhibitor and NOD2/CARD15 genotyping predicts complicated Crohn's disease behaviour.
17258734 2007 NOD2 variants and antibody response to microbial antigens in Crohn's disease patients and their unaffected relatives.
17206688 2007 Antibodies to saccharomyces cerevisiae in Crohn's disease: higher titers are associated with a greater frequency of mutant NOD2/CARD15 alleles and with a higher probability of complicated disease.
17206636 2007 The prevalence of genetic and serologic markers in an unselected European population-based cohort of IBD patients.
17206080 2007 Relationship between clinical features of Crohn's disease and the risk of developing extraintestinal manifestations.
17200669 2007 A genome-wide association scan of nonsynonymous SNPs identifies a susceptibility variant for Crohn disease in ATG16L1.
17187069 2007 The adaptor protein CARD9 is required for innate immune responses to intracellular pathogens.
17174426 2007 CARD15 variants in patients with sporadic Parkinson's disease.
17171451 2007 Polymorphisms in genes related to bacterial lipopolysaccharide/peptidoglycan signaling and gastric precancerous lesions in a population at high risk for gastric cancer.
17160430 2006 Incidence of Crohn's disease and CARD15 mutation in a small township in Sicily.
17157607 2006 Blau syndrome associated with a CARD15/NOD2 mutation.
17156193 2007 NOD protein expression and function in first trimester trophoblast cells.
17156146 2007 DLG5 R30Q variant is a female-specific protective factor in pediatric onset Crohn's disease.
17142621 2006 Intestinal permeability in families with Crohn's disease.
17131470 2006 Associations between NOD2/CARD15 genotype and phenotype in Crohn's disease--Are we there yet?
17119385 2006 Predictive value of the CARD15 variant 1007fs for the diagnosis of intestinal stenoses and the need for surgery in Crohn's disease in clinical practice: results of a prospective study.
17113749 2007 Host susceptibility to tuberculosis: CARD15 polymorphisms in a South African population.
17101573 2006 Homozygosity for the CARD15 frameshift mutation 1007fs is predictive of early onset of Crohn's disease with ileal stenosis, entero-enteral fistulas, and frequent need for surgical intervention with high risk of re-stenosis.
17100976 2007 A population-based case-control study of CARD15 and other risk factors in Crohn's disease and ulcerative colitis.
17100974 2007 Genetic polymorphisms associated with inflammatory bowel disease do not confer risk for primary sclerosing cholangitis.
17096091 2007 Altered host:pathogen interactions conferred by the Blau syndrome mutation of NOD2.
17068223 2006 A genome-wide association study identifies IL23R as an inflammatory bowel disease gene.
17058067 2006 Aberrant intestinal expression and allelic variants of mucin genes associated with inflammatory bowel disease.
17057186 2006 CARD15/NOD2 mutations in Crohn's disease.
17030188 2006 TUCAN (CARD8) genetic variants and inflammatory bowel disease.
17020469 2006 Frequency of CARD15 polymorphisms in patients with Crohn's disease from Toledo, Spain: genotype-phenotype correlation.
17018387 2006 Effect of NOD2/CARD15 variants in T-cell depleted allogeneic stem cell transplantation.
17012967 2006 Complex insertion/deletion polymorphism in NOD1 (CARD4) is not associated with inflammatory bowel disease susceptibility in East Anglia panel.
17009307 2006 Pediatric granulomatous arthritis: an international registry.
17006998 2006 Prevalence of SLC22A4, SLC22A5 and CARD15 gene mutations in Hungarian pediatric patients with Crohn's disease.
17005562 2006 Centaurin beta1 down-regulates nucleotide-binding oligomerization domains 1- and 2-dependent NF-kappaB activation.
16977346 2007 NOD2 allele variants in patients with rheumatoid arthritis.
16965521 2006 CARD15 gene variants in aggressive periodontitis.
16952484 2006 TNFalpha genotype influences development of IgA-ASCA antibodies in Crohn's disease patients with CARD15 wild type.
16949315 2006 Nucleotide binding oligomerization domain 2 deficiency leads to dysregulated TLR2 signaling and induction of antigen-specific colitis.
16933467 2006 CARD15/NOD2, CD14, and toll-like receptor 4 gene polymorphisms in Greek patients with sarcoidosis.
16920047 2006 CARD15 in inflammatory bowel disease and Crohn's disease phenotypes: an association study and pooled analysis.
16907704 2006 Lack of association between genetic variation in 9 innate immunity genes and baseline CRP levels.
16897777 2006 Microbial induction of CARD15 expression in intestinal epithelial cells via toll-like receptor 5 triggers an antibacterial response loop.
16840031 2006 NOD2/CARD15 and Toll-like 4 receptor gene polymorphism in Chilean patients with inflammatory bowel disease.
16825909 2006 NOD2/CARD15 mutations in Croatian patients with Crohn's disease: prevalence and genotype-phenotype relationship.
16819374 2006 Ileal lymphonodular hyperplasia is not associated with NOD2/CARD15 mutations.
16804670 2007 NOD2/CARD15 gene polymorphisms are not associated with collagenous colitis.
16804398 2006 Role of the NFKB1 -94ins/delATTG promoter polymorphism in IBD and potential interactions with polymorphisms in the CARD15/NOD2, IKBL, and IL-1RN genes.
16773683 2006 NOD2: ethnic and geographic differences.
16771961 2006 Contribution of OCTN variants within the IBD5 locus to pediatric onset Crohn's disease.
16741608 2006 NOD2/CARD15, NOD1/CARD4, and ICAM-1 gene polymorphisms in Turkish patients with inflammatory bowel disease.
16716969 2006 Contribution of CARD15 variants in determining susceptibility to Crohn's disease in Sweden.
16714539 2006 Role for erbin in bacterial activation of Nod2.
16670524 2006 DLG5 R30Q is not associated with IBD in Hungarian IBD patients but predicts clinical response to steroids in Crohn's disease.
16670523 2006 Relationship between CARD15, SLC22A4/5, and DLG5 polymorphisms and early-onset inflammatory bowel diseases: an Italian multicentric study.
16669960 2006 Increased intestinal permeability and NOD2 variants in familial and sporadic Crohn's disease.
16642031 2006 The role of inflammatory bowel disease susceptibility loci in multiple sclerosis and systemic lupus erythematosus.
16641610 2006 No evidence of association between NOD2/CARD15 gene polymorphism and atherosclerotic events after renal transplantation.
16614992 2006 Distribution of common CARD15 variants in patients with sporadic Crohn's disease: cases from Turkey.
16611251 2006 TNF-857 polymorphism in Israeli Jewish patients with inflammatory bowel disease.
16534418 2006 Genetic variants in TNF-alpha but not DLG5 are associated with inflammatory bowel disease in a large United Kingdom cohort.
16522788 2006 Nucleotide oligomerization domain 2 (Nod2) is not involved in the pattern recognition of Candida albicans.
16519819 2006 Analysis of polymorphisms in 16 genes in type 1 diabetes that have been associated with other immune-mediated diseases.
16510569 2006 Caspase recruitment domain-containing protein 15 mutations in patients with colorectal cancer.
16494592 2006 DLG5 variants in inflammatory bowel disease.
16494109 NOD2/CARD15 in healthy relatives of IBD patients.
16493449 2006 Extreme heterogeneity in CARD15 and DLG5 Crohn disease-associated polymorphisms between German and Norwegian populations.
16493424 2006 Signalling pathways and molecular interactions of NOD1 and NOD2.
16492792 2006 A short isoform of NOD2/CARD15, NOD2-S, is an endogenous inhibitor of NOD2/receptor-interacting protein kinase 2-induced signaling pathways.
16489646 2006 Polymorphisms in interleukin-10 gene according to mutations of NOD2/CARD15 gene and relation to phenotype in Spanish patients with Crohn's disease.
16485124 2006 Eight novel CARD15 variants detected by DNA sequence analysis of the CARD15 gene in 111 patients with inflammatory bowel disease.
16461743 2006 Impaired dendritic cell function in Crohn's disease patients with NOD2 3020insC mutation.
16454837 2006 Contribution of IBD5 locus to clinical features of IBD patients.
16446977 2006 Evidence of transmission ratio distortion of DLG5 R30Q variant in general and implication of an association with Crohn disease in men.
16441470 2006 Variants of OCTN1-2 cation transporter genes are associated with both Crohn's disease and ulcerative colitis.
16437728 2005 Single nucleotide polymorphisms of OCTN1, OCTN2, and DLG5 genes in Greek patients with Crohn's disease.
16437636 2005 Combined carriership of TLR9-1237C and CD14-260T alleles enhances the risk of developing chronic relapsing pouchitis.
16436969 2006 Mutations in innate immune system NOD2/CARD 15 and TLR-4 (Thr399Ile) genes influence the risk for severe acute graft-versus-host disease in patients who underwent an allogeneic transplantation.
16424393 2006 Prognostic significance of NOD2/CARD15 variants in HLA-identical sibling hematopoietic stem cell transplantation: effect on long-term outcome is confirmed in 2 independent cohorts and may be modulated by the type of gastrointestinal decontamination.
16416181 2005 Gastroduodenal Crohn's disease is associated with NOD2/CARD15 gene polymorphisms, particularly L1007P homozygosity.
16414084 2006 Human endothelial cells express NOD2/CARD15 and increase IL-6 secretion in response to muramyl dipeptide.
16402184 2006 CARD15 mutations in patients with plaque-type psoriasis and psoriatic arthritis: lack of association.
16397396 2007 CARD15 single nucleotide polymorphisms 8, 12 and 13 are not increased in ethnic Danes with sarcoidosis.
16393227 2005 Intestinal permeability and genetic determinants in patients, first-degree relatives, and controls in a high-incidence area of Crohn's disease in Southern Italy.
16389181 2006 Genetic variation in TNF and IL10 and risk of non-Hodgkin lymphoma: a report from the InterLymph Consortium.
16385250 2006 Genetic polymorphisms of CD14, toll-like receptor 4, and caspase-recruitment domain 15 are not associated with necrotizing enterocolitis in very low birth weight infants.
16344054 2005 The contribution of OCTN1/2 variants within the IBD5 locus to disease susceptibility and severity in Crohn's disease.
16344053 2005 Association of organic cation transporter risk haplotype with perianal penetrating Crohn's disease but not with susceptibility to IBD.
16319062 2006 NOD2/CARD15 mediates induction of the antimicrobial peptide human beta-defensin-2.
16315780 2005 NOD2/CARD15 gene polymorphisms in idiopathic pulmonary fibrosis.
16306764 2005 Association of polymorphisms in the interleukin-18 gene in patients with Crohn's disease depending on the CARD15/NOD2 genotype.
16279904 2005 Disease concordance, zygosity, and NOD2/CARD15 status: follow-up of a population-based cohort of Danish twins with inflammatory bowel disease.
16278823 2006 Mutation, selection, and evolution of the Crohn disease susceptibility gene CARD15.
16267612 2006 Prevalence of the NOD2 3020insC mutation in aggregations of breast and lung cancer.
16266221 2005 Association of NOD2/CARD15 mutations with previous surgical procedures in Crohn's disease.
16260731 2005 IL-32 synergizes with nucleotide oligomerization domain (NOD) 1 and NOD2 ligands for IL-1beta and IL-6 production through a caspase 1-dependent mechanism.
16257953 2006 Analysis of NOD2-mediated proteome response to muramyl dipeptide in HEK293 cells.
16255050 2005 Evidence for common genetic control in pathways of inflammation for Crohn's disease and psoriatic arthritis.
16244543 2005 Crohn's disease patients carrying Nod2/CARD15 gene variants have an increased and early need for first surgery due to stricturing disease and higher rate of surgical recurrence.
16239841 2005 Innate immune receptor genetic polymorphisms in pouchitis: is CARD15 a susceptibility factor?
16239840 2005 Genotype-phenotype analysis in childhood-onset Crohn's disease: NOD2/CARD15 variants consistently predict phenotypic characteristics of severe disease.
16230083 2005 Nod2 in normal and abnormal intestinal immune function.
16203728 2005 A role for Erbin in the regulation of Nod2-dependent NF-kappaB signaling.
16198136 2005 Crohn's disease associated CARD15 (NOD2) variants are not involved in the susceptibility to type 1 diabetes.
16179784 2005 NOD2/CARD15 gene polymorphisms in Crohn's disease: a genotype-phenotype analysis in Danish and Portuguese patients and controls.
16174099 2005 Polymorphisms of CARD15/NOD2 and CD14 genes in New Zealand Crohn's disease patients.
16167972 2005 Carriage of CARD15 variants and smoking as risk factors for resective surgery in patients with Crohn's ileal disease.
16161956 2005 [Does smoking influence the course of Crohn's disease in patients with the presence of gene NOD2/CARD15 mutation?].
16148063 2005 Is age of onset of Crohn's disease governed by mutations in NOD2/caspase recruitment domains 15 and Toll-like receptor 4? Evaluation of a pediatric cohort.
16134731 CARD15 polymorphisms in Behçet's disease.
16134725 Analysis of CARD15/NOD2 haplotypes fails to identify common variants associated with rheumatoid arthritis susceptibility.
16133971 2005 The relation between NOD2/CARD15 mutations and the prevalence and phenotypic heterogeneity of Crohn's disease: lessons from the Israeli Arab Crohn's disease cohort.
16126943 2005 Crohn's disease is associated with polymorphism of CARD15/NOD2 gene in a Hungarian population.
16115863 2005 The frameshift mutation in Nod2 results in unresponsiveness not only to Nod2- but also Nod1-activating peptidoglycan agonists.
16080653 [Nosocomial sepsis and polymorphism of the NOD-2 gene].
16010583 2005 Consequence of functional Nod2 and Tlr4 mutations on gene transcription in Crohn's disease patients.
16009674 2005 Influence of IL-6, COL1A1, and VDR gene polymorphisms on bone mineral density in Crohn's disease.
16008671 2005 Association of CARD15 polymorphisms with atopy-related traits in a population-based cohort of Caucasian adults.
16002353 2005 CARD15/NOD2 polymorphisms do not explain concordance of Crohn's disease in Swedish monozygotic twins.
16000642 2006 Genetic basis for increased intestinal permeability in families with Crohn's disease: role of CARD15 3020insC mutation?
15998797 2005 Membrane recruitment of NOD2 in intestinal epithelial cells is essential for nuclear factor-{kappa}B activation in muramyl dipeptide recognition.
15990626 2005 Influence of CARD15 mutations on disease activity and response to therapy in 65 pediatric Crohn patients from Saxony, Germany.
15984988 2005 TNF promoter polymorphisms and modulation of growth retardation and disease severity in pediatric Crohn's disease.
15973118 2005 The role of Toll-like receptor 4 Asp299Gly and Thr399Ile polymorphisms and CARD15/NOD2 mutations in the susceptibility and phenotype of Crohn's disease.
15973116 2005 Comparative phenotypic and CARD15 mutational analysis among African American, Hispanic, and White children with Crohn's disease.
15967716 2005 NLRs join TLRs as innate sensors of pathogens.
15967635 2005 Analysis of the three common mutations in the CARD15 gene (R702W, G908R and 1007fs) in South African colored patients with inflammatory bowel disease.
15930978 2005 Recent advances in the genetics of inflammatory bowel disease.
15927452 2005 The cytosolic pattern-recognition receptor Nod2 and inflammatory granulomatous disorders.
15843082 2005 A functional interleukin-10 mutation in Dutch patients with Crohn's disease.
15842589 2005 Tumor necrosis factor receptor gene polymorphisms in Crohn's disease: association with clinical phenotypes.
15840263 2005 [NOD2/CARD15 gene polymorphisms and susceptibility to Crohn's disease in Chinese Han population].
15812565 2005 A new CARD15 mutation in Blau syndrome.
15807862 2005 CARD15 polymorphisms are associated with anti-Saccharomyces cerevisiae antibodies in caucasian Crohn's disease patients.
15803022 2005 NOD2/CARD15 and TNFA, but not IL1B and IL1RN, are associated with Crohn's disease.
15800781 2005 Functional interaction of CARD15/NOD2 and Crohn's disease-associated TNFalpha polymorphisms.