Property Summary

NCBI Gene PubMed Count 11
PubMed Score 69.32
PubTator Score 118.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 733 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.6e-183
osteosarcoma 7766 3.9e-11
ovarian cancer 8297 5.9e-10
lung cancer 4607 8.8e-03
astrocytic glioma 2530 2.5e-02
oligodendroglioma 2768 3.2e-02
ependymoma 4559 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Cataract 7 32 3.091 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 2.5e-02
ependymoma -1.700 4.1e-02
lung cancer -1.100 8.8e-03
oligodendroglioma -1.500 3.2e-02
osteosarcoma -4.304 3.9e-11
ovarian cancer 1.200 5.9e-10
psoriasis 1.700 1.6e-183

Gene RIF (8)

AA Sequence

MFHSPRRLCSALLQRDAPGLRRLPAPGLRRPLSPPAAVPRPASPRLLAAASAASGAARSCSRTVCSMGTG      1 - 70
TSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTH     71 - 140
PPIRVMQWNILAQALGEGKDNFVQCPVEALKWEERKCLILEEILAYQPDILCLQEVDHYFDTFQPLLSRL    141 - 210
GYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQNRFKLVNSANIRLTAMTLKTNQVAIAQTLECKESGRQF    211 - 280
CIAVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKL    281 - 350
LSADGQSEPPYTTWKIRTSGECRHTLDYIWYSKHALNVRSALDLLTEEQIGPNRLPSFNYPSDHLSLVCD    351 - 420
FSFTEESDGLS                                                               421 - 431
//

Text Mined References (14)

PMID Year Title