Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.75
PubTator Score 5.96

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.414 4.4e-03
chronic lymphocytic leukemia 1.202 1.0e-02
glioblastoma 1.300 9.6e-03
atypical teratoid / rhabdoid tumor 1.100 9.3e-05
tuberculosis and treatment for 3 months -1.100 4.3e-04
lung cancer 1.800 1.1e-03
colon cancer 1.100 4.0e-03
group 3 medulloblastoma 1.400 1.5e-03
pilocytic astrocytoma 1.100 2.1e-04
posterior fossa group A ependymoma 1.100 3.2e-06
acute myeloid leukemia -1.100 2.8e-02
ovarian cancer -1.400 3.1e-04


Accession Q8WTT2 Q9H5M6 Q9H9D8 NOC3 protein homolog
Symbols AD24


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

24146276 We found PLCE1, C11orf92-C11orf93, and NOC3L associated with colorectal cancer susceptibility
22796266 Results indicate the importance of four gastric cancer susceptibility polymorphisms of IL-10, NOC3L, PSCA and MTRR in the Chinese Han population.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15564382 Fad24, a mammalian homolog of Noc3p, is a positive regulator in adipocyte differentiation.

AA Sequence

DLNQLIKRYSSEVATESPLDFTKYLKTSLH                                            771 - 800

Text Mined References (19)

PMID Year Title
24146276 2014 Genetic association of PLCE1, C11orf92-C11orf93, and NOC3L with colorectal cancer risk in the Han population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22796266 2012 Polymorphisms of tumor-related genes IL-10, PSCA, MTRR and NOC3L are associated with the risk of gastric cancer in the Chinese Han population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
20729852 2010 A shared susceptibility locus in PLCE1 at 10q23 for gastric adenocarcinoma and esophageal squamous cell carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18520036 2008 FAD24, a regulator of adipogenesis, is required for the regulation of DNA replication in cell proliferation.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15564382 2004 Fad24, a mammalian homolog of Noc3p, is a positive regulator in adipocyte differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.