Property Summary

NCBI Gene PubMed Count 15
PubMed Score 36.94
PubTator Score 12.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.300 3.2e-04
ovarian cancer 1.100 1.2e-03

Gene RIF (4)

PMID Text
25072814 Our results uncovered an unexpected, mandatory detour of NOA1 through the nucleolus before uptake into mitochondria.
22447445 This study indicates rhat C4orf14 is involved in 28S subunit biogenesis and mtDNA maintenance.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18456285 The present study suggests a novel function for mAtNOS1 in regulating mitochondrial nitric oxide and calcium and inducing apoptosis of MCF-7 cells

AA Sequence

MLPARLPFRLLSLFLRGSAPTAARHGLREPLLERRCAAASSFQHSSSLGRELPYDPVDTEGFGEGGDMQE      1 - 70
RFLFPEYILDPEPQPTREKQLQELQQQQEEEERQRQQRREERRQQNLRARSREHPVVGHPDPALPPSGVN     71 - 140
CSGCGAELHCQDAGVPGYLPREKFLRTAEADGGLARTVCQRCWLLSHHRRALRLQVSREQYLELVSAALR    141 - 210
RPGPSLVLYMVDLLDLPDALLPDLPALVGPKQLIVLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLA    211 - 280
PGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGVEELISALQRSWRYRGDVYLVGATNAG    281 - 350
KSTLFNTLLESDYCTAKGSEAIDRATISPWPGTTLNLLKFPICNPTPYRMFKRHQRLKKDSTQAEEDLSE    351 - 420
QEQNQLNVLKKHGYVVGRVGRTFLYSEEQKDNIPFEFDADSLAFDMENDPVMGTHKSTKQVELTAQDVKD    421 - 490
AHWFYDTPGITKENCILNLLTEKEVNIVLPTQSIVPRTFVLKPGMVLFLGAIGRIDFLQGNQSAWFTVVA    491 - 560
SNILPVHITSLDRADALYQKHAGHTLLQIPMGGKERMAGFPPLVAEDIMLKEGLGASEAVADIKFSSAGW    561 - 630
VSVTPNFKDRLHLRGYTPEGTVLTVRPPLLPYIVNIKGQRIKKSVAYKTKKPPSLMYNVRKKKGKINV      631 - 698
//

Text Mined References (19)

PMID Year Title
25072814 2014 NOA1, a novel ClpXP substrate, takes an unexpected nuclear detour prior to mitochondrial import.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22447445 2012 Human C4orf14 interacts with the mitochondrial nucleoid and is involved in the biogenesis of the small mitochondrial ribosomal subunit.
21909106 2011 Genome-wide association study identifies two susceptibility loci for exudative age-related macular degeneration in the Japanese population.
21771794 2011 Nitric oxide-associated protein 1 (NOA1) is necessary for oxygen-dependent regulation of mitochondrial respiratory complexes.
21269460 2011 Initial characterization of the human central proteome.
21118999 2011 NOA1 is an essential GTPase required for mitochondrial protein synthesis.
21106707 2011 A genetic variant near the PMAIP1/Noxa gene is associated with increased bleomycin sensitivity.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19103604 2009 hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis.
18456285 2008 mAtNOS1 induces apoptosis of human mammary adenocarcinoma cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16380119 2006 Mammalian mitochondrial nitric oxide synthase: characterization of a novel candidate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2118999 1990 Studies of an 800-kilobase DNA stretch of the Drosophila X chromosome: comapping of a subclass of scaffold-attached regions with sequences able to replicate autonomously in Saccharomyces cerevisiae.