Property Summary

NCBI Gene PubMed Count 60
PubMed Score 108.99
PubTator Score 99.65

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (51)

PMID Text
26571212 Data show that nicotinamide N-methyltransferase (NNMT) and the metabolic state regulate pluripotency in embryonic stem cells (hESCs).
26456643 results further reinforce a central role for NNMT in the regulation of energy homeostasis and provide further mechanistic insight into the consequences of enhanced NNMT expression
26168293 increasing Nnmt expression or MNAM levels stabilizes sirtuin 1 protein, an effect that is required for their metabolic benefits
25596852 White adipose tissue NNMT expression is regulated in human insulin resistance and type 2 diabetes and that plasma MNA correlates with increased tissue NNMT expression and the degree of insulin resistance.
25592232 Data sugguest that NNMT plays an important role in PANC-1 cell proliferation, metastatic potential and survival under metabolic stress.
25547204 There were no associations between MTHFR C677T, NNMT rs694539 AG/AA polymorphisms and conotruncal heart disease.
25317069 results suggest that the NNMT SNP rs694539 may have a role in the etiology of schizophrenia in a Han Chinese female population
25204218 The downregulation of NNMT significantly reduced in vitro tumorigenicity of A549 cells.
25201588 NNMT enhances the capacity of tumorigenesis associated with the inhibition of cell apoptosis and the promotion of cell cycle progression in human colorectal cancer cells
25115443 NNMT is associated with microRNA-1291-altered pancreatic carcinoma cell metabolome and suppressed tumorigenesis.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of nicotinamide N-methyltransferase (NNMT) in primary human brain microvascular endothelial cells
24558488 Down-regulation of NNMT induces apoptosis via the mitochondria-mediated pathway in breast cancer cells.
24004542 Genetic association of the rs694539 variant of nicotinamide-N-methyltransferase gene with bipolar disorder.
23964925 The rs694539 variant of NNMT gene is a genetic risk factor for developing nonalcoholic steatohepatitis.
23838801 Data indicate that nicotinamide N-methyltransferase (NNMT) positively correlated with protein kinase B (pAkt) expression and was independent adverse prognosticators of patient survival.
23764850 NNMT expression regulates neurone morphology in vitro via the sequential activation of the EFNB2 and Akt cellular signalling pathways.
23479363 High serum NNMT is associated with kidney cancer.
23455543 using metabolomics, observation that NNMT impairs the methylation potential of cancer cells by consuming methyl units from S-adenosyl methionine to create the stable metabolic product 1-methylnicotinamide
23097023 The nicotinamide N-methyltransferase expression levels were significantly higher in patients with bladder tumor compared to controls that showed very low or undetectable amounts of NNMT transcript and protein.
22628313 a marked increase in enzyme activity in oral cancer
21823666 Structural basis of substrate recognition in human nicotinamide N-methyltransferase
21791160 This study suggested that NNMT is involved in the aetiology of schizophrenia
21045016 NNMT has a crucial role in cellular invasion via activating PI3K/Akt/SP1/MMP-2 pathway in clear cell renal cell carcinoma (ccRCC).
20634891 Observational study of gene-disease association. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
20104648 NNMT is over-expressed in a large proportion in renal cell cancers. High NNMT expression is significantly associated with unfavorable prognosis.
19924637 the present study suggests that NNMT may have potential as a biomarker and as a therapeutic target for OSCCoral squamous cell carcinoma
19812220 Observational study of gene-disease association. (HuGE Navigator)
19619240 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19242722 serum levels of NNMT were significantly higher in lung cancer patients than in COPD patients and healthy donors
19216803 NNMT gene expression is associated with tumor stage and DFS time in hepatocellular carcinoma cases.
19161160 Observational study of gene-disease association. (HuGE Navigator)
19020309 For the first time, we associate the RFC1 80G>A and NNMT IVS -151C>T variants to an increased acute lymphoblastic leukemia susceptibility.
19020309 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18996527 Adipose tissue ss a source of nicotinamide N-methyltransferase and homocysteine
18724390 analysis identified genes known to be associated with cell invasion such as versican, and novel ones, including metallothionein 1E (MT1E) and nicotinamide N-methyltransferase (NNMT)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18553462 No association was found between infant nicotinamide N-methyl transferase gene variants and risk for spina bifida in our study population.
18553462 Observational study of gene-disease association. (HuGE Navigator)
18441319 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)
17922140 NNMT is a novel Stat3-regulated gene and may be a potential candidate for a tumor marker of various kinds of cancers
17434578 NNMT genotype is not a strong determinant of the tHcy concentration but it may have a modifying effect on plasma homocysteine concentration in Japanese men
17412799 Observational study of gene-disease association. (HuGE Navigator)
16676400 depsipeptide represses NNMT and HNF-1beta gene expression in some papillary thyroid cancer cells
16166432 NNMT serum levels may have significance in the early detection and in the management of patients with colorectal cancer.
15849667 A genomewide exploration suggested NNMT as a new candidate and major determinant of plasma homocystein levels.
15486044 HNF-1beta functions as a transcription activator for NNMT gene expression in some papillary thyroid cancer cells
12216074 A potential role in predicting response to radiation in bladder cancer

AA Sequence

MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ      1 - 70
LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK     71 - 140
CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK    141 - 210
FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL                    211 - 264
//

Text Mined References (63)

PMID Year Title
26571212 2015 The metabolome regulates the epigenetic landscape during naive-to-primed human embryonic stem cell transition.
26456643 2015 Nicotinamide N-methyltransferase increases complex I activity in SH-SY5Y cells via sirtuin 3.
26168293 2015 Nicotinamide N-methyltransferase regulates hepatic nutrient metabolism through Sirt1 protein stabilization.
25596852 2015 Association of nicotinamide-N-methyltransferase mRNA expression in human adipose tissue and the plasma concentration of its product, 1-methylnicotinamide, with insulin resistance.
25592232 2015 Effects of nicotinamide N-methyltransferase on PANC-1 cells proliferation, metastatic potential and survival under metabolic stress.
25547204 2015 Association of MTHFR A1298C polymorphism with conotruncal heart disease.
25317069 2014 Female specific association between NNMT gene and schizophrenia in a Han Chinese population.
25204218 2015 Role of nicotinamide N-methyltransferase in non-small cell lung cancer: in vitro effect of shRNA-mediated gene silencing on tumourigenicity.
25201588 2014 Nicotinamide N-methyltransferase enhances the capacity of tumorigenesis associated with the promotion of cell cycle progression in human colorectal cancer cells.
25115443 2014 N-methylnicotinamide and nicotinamide N-methyltransferase are associated with microRNA-1291-altered pancreatic carcinoma cell metabolome and suppressed tumorigenesis.
24558488 2014 Down-regulation of nicotinamide N-methyltransferase induces apoptosis in human breast cancer cells via the mitochondria-mediated pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24004542 2013 Association of nicotinamide-N-methyltransferase (NNMT) gene rs694539 variant with bipolar disorder.
23964925 2013 Association of nicotinamide-N-methyltransferase gene rs694539 variant with patients with nonalcoholic steatohepatitis.
23838801 2013 Nicotinamide N-methyltransferase overexpression is associated with Akt phosphorylation and indicates worse prognosis in patients with nasopharyngeal carcinoma.
23764850 2013 Nicotinamide N-methyltransferase expression in SH-SY5Y neuroblastoma and N27 mesencephalic neurones induces changes in cell morphology via ephrin-B2 and Akt signalling.
23479363 2013 Composite three-marker assay for early detection of kidney cancer.
23455543 2013 NNMT promotes epigenetic remodeling in cancer by creating a metabolic methylation sink.
23097023 2013 Upregulation of tissue and urinary nicotinamide N-methyltransferase in bladder cancer: potential for the development of a urine-based diagnostic test.
22628313 2012 Analysis of tissue and salivary nicotinamide N-methyltransferase in oral squamous cell carcinoma: basis for the development of a noninvasive diagnostic test for early-stage disease.
21823666 2011 Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
21791160 2012 Nicotinamide-N-methyltransferase (NNMT) in schizophrenia: genetic association and decreased frontal cortex mRNA levels.
21269460 2011 Initial characterization of the human central proteome.
21045016 2011 Nicotinamide N-methyltransferase induces cellular invasion through activating matrix metalloproteinase-2 expression in clear cell renal cell carcinoma cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20104648 2010 Nicotinamide N-methyltransferase protein expression in renal cell cancer.
19924637 2010 Nicotinamide N-Methyltransferase upregulation correlates with tumour differentiation in oral squamous cell carcinoma.
19812220 2009 Body mass index is an important determinant of methylation biomarkers in women of reproductive ages.
19619240 2010 The relationship between homocysteine and genes of folate-related enzymes in migraine patients.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19242722 2009 Serum levels of nicotinamide N-methyltransferase in patients with lung cancer.
19216803 2009 Expression of nicotinamide N-methyltransferase in hepatocellular carcinoma is associated with poor prognosis.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19020309 2009 Polymorphisms in folate-related genes and risk of pediatric acute lymphoblastic leukemia.
18996527 2009 Adipose tissue as a source of nicotinamide N-methyltransferase and homocysteine.
18724390 2008 Overlapping gene expression profiles of cell migration and tumor invasion in human bladder cancer identify metallothionein 1E and nicotinamide N-methyltransferase as novel regulators of cell migration.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18553462 2008 Nicotinamide N-methyl transferase (NNMT) gene polymorphisms and risk for spina bifida.
18441319 2008 Eight-fold increased risk for congenital heart defects in children carrying the nicotinamide N-methyltransferase polymorphism and exposed to medicines and low nicotinamide.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
17922140 2008 Stat3 up-regulates expression of nicotinamide N-methyltransferase in human cancer cells.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
17434578 2007 The relation between nicotinamide N-methyltransferase gene polymorphism and plasma homocysteine concentration in healthy Japanese men.
17412799 2007 Genetic and environmental influences on plasma homocysteine: results from a Danish twin study.
16676400 2006 Histone deacetylase inhibitor depsipeptide represses nicotinamide N-methyltransferase and hepatocyte nuclear factor-1beta gene expression in human papillary thyroid cancer cells.
16166432 2005 Identification of nicotinamide N-methyltransferase as a novel serum tumor marker for colorectal cancer.
15849667 2005 A genomewide exploration suggests a new candidate gene at chromosome 11q23 as the major determinant of plasma homocysteine levels: results from the GAIT project.
15728403 2005 Parkinson's disease: the first common neurological disease due to auto-intoxication?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486044 2005 Activation of nicotinamide N-methyltransferase gene promoter by hepatocyte nuclear factor-1beta in human papillary thyroid cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216074 2002 A potential role of heat shock proteins and nicotinamide N-methyl transferase in predicting response to radiation in bladder cancer.
11853016 2002 Expression of nicotinamide N-methyltransferase (E.C. 2.1.1.1) in the Parkinsonian brain.
11271497 2000 Human ERp29: isolation, primary structural characterisation and two-dimensional gel mapping.
10471062 1999 Human nicotinamide N-methyltransferase pharmacogenetics: gene sequence analysis and promoter characterization.
9804963 1998 A direct correlation between nicotinamide N-methyltransferase activity and protein levels in human liver cytosol.
8845860 1996 Mouse liver nicotinamide N-methyltransferase pharmacogenetics: biochemical properties and variation in activity among inbred strains.
8575745 1995 Human nicotinamide N-methyltransferase gene: molecular cloning, structural characterization and chromosomal localization.
8182091 1994 Human liver nicotinamide N-methyltransferase. cDNA cloning, expression, and biochemical characterization.
1533573 1992 Fluorometric assay of rat tissue N-methyltransferases with nicotinamide and four isomeric methylnicotinamides.