Property Summary

NCBI Gene PubMed Count 22
PubMed Score 101.28
PubTator Score 75.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 1.5e-12
Astrocytoma, Pilocytic -1.500 1.4e-05
cystic fibrosis -1.193 5.5e-05
glioblastoma multiforme -1.100 1.6e-09
group 4 medulloblastoma 3.700 1.5e-08
lung carcinoma 1.300 3.2e-07
medulloblastoma, large-cell 1.700 3.5e-04
oligodendroglioma -1.200 2.3e-12
pituitary cancer -3.000 3.2e-04
psoriasis -1.100 6.8e-29

Gene RIF (14)

AA Sequence

MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQ      1 - 70
VLGERRQRAPN                                                                71 - 81
//

Text Mined References (23)

PMID Year Title