Property Summary

NCBI Gene PubMed Count 22
PubMed Score 96.03
PubTator Score 75.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 1.5e-12
glioblastoma multiforme -1.100 1.6e-09
oligodendroglioma -1.200 2.3e-12
group 4 medulloblastoma 3.700 1.5e-08
cystic fibrosis -1.193 5.5e-05
medulloblastoma, large-cell 1.700 3.5e-04
pilocytic astrocytoma -1.500 1.2e-05
lung carcinoma 1.300 3.2e-07
pituitary cancer -3.000 3.2e-04
psoriasis -1.100 6.8e-29

Synonym

Accession Q16517 B2R558 E1P5V6 Q16596 Q5U0N3
Symbols Peg5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (14)

PMID Text
24345642 Neuronatin gene: Imprinted and misfolded: Studies in Lafora disease, diabetes and cancer may implicate NNAT-aggregates as a common downstream participant in neuronal loss.
24345474 Data suggest NNAT as a potential tumor suppressor in myxoid liposarcomas.
24252747 indicate that Nnat is related to keratinocyte differentiation by up-regulating involucrin expression
23825673 methylation status of a not-yet-described regulatory element within the NNAT locus that contains four potential CTCF binding sites determines the expression level of NNAT
23408434 Neuronatin-mediated aberrant calcium signaling and endoplasmic reticulum stress underlie neuropathology in Lafora disease
22624064 Neuronatin in a subset of glioblastoma multiforme tumor progenitor cells is associated with increased cell proliferation and shorter patient survival.
22022350 A stringent analysis identified NNAT as a key imprinted gene that was dysregulated in induced pluripotent stem cells.
21742036 malin negatively regulates neuronatin and its loss of function in Lafora disease results in increased accumulation of neuronatin
19851307 A putative role of Nnat in human energy homeostasis is further emphasized by a consistent association between single nucleotide polymorphisms (SNPs) in the human Nnat gene and severe childhood and adult obesity
19218280 Loss of neuronatin expression is associated with promoter hypermethylation in pituitary adenoma.
18701710 frequently observed overexpression of both neuronatin splice forms in medulloblastomaenhances growth in this cancer
17805055 Neuronatin expression is associated with poor prognosis in patients with adenocarcinoma, and may be useful as a prognostic marker for lung adenocarcinoma.
12775420 Downregulation of guanine nucleotide-releasing protein, CD151/PETA-3, neuronatin, neuroendocrine differentiation factor, mitochondria 16s rRNA, and signal recognition particle is observed in HIV-1 infected and HIV-1 gp120-treated astrocytes
11960906 Hypermethylation of the imprinted NNAT locus occurs frequently in pediatric acute leukemia

AA Sequence

MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQ      1 - 70
VLGERRQRAPN                                                                71 - 81
//

Text Mined References (23)

PMID Year Title
27109921 2016 Neuronatin is a stress-responsive protein of rod photoreceptors.
24345642 Neuronatin gene: Imprinted and misfolded: Studies in Lafora disease, diabetes and cancer may implicate NNAT-aggregates as a common downstream participant in neuronal loss.
24345474 2013 Integrative DNA methylation and gene expression analysis in high-grade soft tissue sarcomas.
24252747 2014 Neuronatin is related to keratinocyte differentiation by up-regulating involucrin.
23825673 2013 Selective methylation of CpGs at regulatory binding sites controls NNAT expression in Wilms tumors.
23408434 2013 Neuronatin-mediated aberrant calcium signaling and endoplasmic reticulum stress underlie neuropathology in Lafora disease.
22624064 2012 Neuronatin in a subset of glioblastoma multiforme tumor progenitor cells is associated with increased cell proliferation and shorter patient survival.
22022350 2011 Suppression of the imprinted gene NNAT and X-chromosome gene activation in isogenic human iPS cells.
21742036 2011 Lafora disease ubiquitin ligase malin promotes proteasomal degradation of neuronatin and regulates glycogen synthesis.
19851307 2010 The imprinted gene neuronatin is regulated by metabolic status and associated with obesity.
19218280 2009 Loss of neuronatin expression is associated with promoter hypermethylation in pituitary adenoma.
18701710 2008 Coexpression of neuronatin splice forms promotes medulloblastoma growth.
17805055 2007 Neuronatin expression and its clinicopathological significance in pulmonary non-small cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11543638 2001 The neuronatin gene resides in a "micro-imprinted" domain on human chromosome 20q11.2.
11476579 2001 Imprinted expression of neuronatin from modified BAC transgenes reveals regulation by distinct and distant enhancers.
9356927 1997 cDNA cloning and mRNA expression analysis of the human neuronatin. High level expression in human pituitary gland and pituitary adenomas.
8813377 1996 Cloning of human neuronatin gene and its localization to chromosome-20q 11.2-12: the deduced protein is a novel "proteolipid'.
8660979 1996 Structure and organization of the human neuronatin gene.