Property Summary

NCBI Gene PubMed Count 35
PubMed Score 12.77
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.300 3.8e-03
Astrocytoma, Pilocytic -1.300 1.0e-05
Atopic dermatitis -1.100 1.5e-03
atypical teratoid / rhabdoid tumor -1.300 5.9e-04
Breast cancer -1.800 1.8e-09
breast carcinoma -1.300 6.7e-04
ductal carcinoma in situ -2.200 1.3e-04
ependymoma -1.900 6.9e-08
fibroadenoma -1.400 2.2e-02
glioblastoma -1.100 5.1e-04
group 4 medulloblastoma -1.500 3.4e-02
head and neck cancer -1.200 3.7e-05
invasive ductal carcinoma -2.200 1.9e-02
lung cancer 1.200 4.8e-03
malignant mesothelioma -1.100 1.6e-06
medulloblastoma, large-cell -2.100 1.1e-02
ovarian cancer -1.400 1.3e-04
primitive neuroectodermal tumor -1.300 2.5e-02
psoriasis -1.200 2.9e-07
subependymal giant cell astrocytoma -1.720 1.7e-02
ulcerative colitis -1.300 6.0e-06

Gene RIF (40)

AA Sequence

MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSAS      1 - 70
DSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAI     71 - 140
EPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL    141 - 210
QWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQ    211 - 280
AVYTAGVVLPKPIATCRYWHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKS    281 - 350
VRELINTYLKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKA    351 - 420
AYSFYNIHTETPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDS    421 - 490
EKVGLVLQ                                                                  491 - 498
//

Text Mined References (38)

PMID Year Title