Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.51
PubTator Score 14.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 9.5e-07
tuberculosis 1563 7.0e-05
osteosarcoma 7933 7.9e-04
oligodendroglioma 2849 2.7e-02

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.500 2.7e-02
osteosarcoma -1.282 7.9e-04
tuberculosis 1.100 7.0e-05
ovarian cancer 2.500 9.5e-07

Synonym

Accession Q9HBL8
Symbols HSCARG
SDR48A1

Gene

PDB

2EXX   2WM3   2WMD   3DXF   3E5M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

PMID Text
26694452 These findings suggest that the increased susceptibility of the G6PD-knockdown cells to viral infection was due to impaired NF-kappaB signaling and antiviral response mediated by HSCARG.
24832601 Data indicate that HSCARG and USP7 function in concert in inhibiting polyubiquination of NEMO, thus inhibiting NF-kappaB activity.
24763515 After viral infection, HSCARG interacted with tumor necrosis receptor-associated factor 3 (TRAF3) and inhibited its ubiquitination by promoting the recruitment of OTUB1 to TRAF3.
24711370 HSCARG is involved in DNA damage response through affecting the level of H2A ubiquitination and localization of RAP80 at lesion points.
23527155 HSCARG regulated reactive-oxygen-species homeostasis through inhibition of NADPH oxidase activity via regulation of the expression of p47phox.
22348310 CRM1 dependent nucleocytoplasmic translocation of HSCARG plays an important role in fine-tuning NF-kappaB signaling
19843583 HSCARG is involved in the NF-kappaB signaling pathway, and negatively regulates NF-kappaB activation.
19433587 HSCARG plays critical roles in regulation of NF-kappaB in response to cellular redox changes by promoting ubiquitination and proteolysis of RelA or COMMD1
19254724 In response to the changes in the NADPH/NADP(+) ratio within cells, HSCARG, as a redox sensor, associates and dissociates with NADPH to form a new dynamic equilibrium.
18263583 HSCARG regulation of argininosuccinate synthetase activity is crucial for maintaining the intracellular balance between redox state and nitric oxide levels
17496144 One of the functions regulated by HSCARG may be argininosuccinate synthetase that is involved in NO synthesis
17100653 expression, crystallization and preliminary X-ray crystallographic studies of HSCARG at a resolution of 2.4 A; crystals belong to F23 space group, with unit cell parameters a=b=c=223.30A, alpha=beta=gamma=90 degrees

AA Sequence

MVDKKLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAEVVQGDQDDQVIMELALN      1 - 70
GAYATFIVTNYWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVEEYF     71 - 140
RDIGVPMTSVRLPCYFENLLSHFLPQKAPDGKSYLLSLPTGDVPMDGMSVSDLGPVVLSLLKMPEKYVGQ    141 - 210
NIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYALRPDRDIELTLRLNP    211 - 280
KALTLDQWLEQHKGDFNLL                                                       281 - 299
//

Text Mined References (19)

PMID Year Title
26694452 2015 Glucose-6-Phosphate Dehydrogenase Enhances Antiviral Response through Downregulation of NADPH Sensor HSCARG and Upregulation of NF-?B Signaling.
24832601 2014 HSCARG downregulates NF-?B signaling by interacting with USP7 and inhibiting NEMO ubiquitination.
24763515 2014 HSCARG negatively regulates the cellular antiviral RIG-I like receptor signaling pathway by inhibiting TRAF3 ubiquitination via recruiting OTUB1.
24711370 2014 HSCARG, a novel regulator of H2A ubiquitination by downregulating PRC1 ubiquitin E3 ligase activity, is essential for cell proliferation.
23527155 2013 HSCARG inhibits NADPH oxidase activity through regulation of the expression of p47phox.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22348310 2012 A CRM1-dependent nuclear export signal controls nucleocytoplasmic translocation of HSCARG, which regulates NF-?B activity.
19843583 2009 HSCARG inhibits activation of NF-kappaB by interacting with IkappaB kinase-beta.
19433587 2009 HSCARG regulates NF-kappaB activation by promoting the ubiquitination of RelA or COMMD1.
19254724 2009 NADPH is an allosteric regulator of HSCARG.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18263583 2008 An NADPH sensor protein (HSCARG) down-regulates nitric oxide synthesis by association with argininosuccinate synthetase and is essential for epithelial cell viability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17496144 2007 Restructuring of the dinucleotide-binding fold in an NADP(H) sensor protein.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17100653 2006 Protein expression, crystallization and preliminary X-ray crystallographic studies on HSCARG from Homo sapiens.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.