Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.88
PubTator Score 9.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Polycystic Ovary Syndrome 334
Disease Target Count P-value
osteosarcoma 7933 3.7e-08
ovarian cancer 8491 5.0e-08
group 4 medulloblastoma 1875 2.9e-06
Disease Target Count Z-score Confidence
Agoraphobia 16 3.17 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.380 3.7e-08
group 4 medulloblastoma 1.500 2.9e-06
ovarian cancer -1.700 5.0e-08

Protein-protein Interaction (4)

Gene RIF (5)

PMID Text
24155910 NMNAT3 is absent in mitochondria in human cells, and, akin to plants and yeast, cytosolic NAD maintains the mitochondrial NAD pool.
20457531 Red blood cells represent the first human cell type with a remarkable predominance of NMNAT3 over NMNAT1; NMNAT2 is absent.
20388704 analysis of isoform-specific targeting and interaction domains in human nicotinamide mononucleotide adenylyltransferases
17402747 NMN binds before ATP with the mitochondrial isozyme NMNAT3. Only NMNAT3 utilizes ITP efficiently in place of ATP, and NMNH conversion to NADH by NMNAT1 and NMNAT3 occurs at similar rates.
16118205 NMNAT1 is a nuclear protein, whereas NMNAT2 and -3 are localized to the Golgi complex and the mitochondria

AA Sequence

MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARL      1 - 70
ALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLK     71 - 140
TFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALG    141 - 210
QGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS                                211 - 252
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24155910 2013 Insight into molecular and functional properties of NMNAT3 reveals new hints of NAD homeostasis within human mitochondria.
20954240 2010 Homology modeling and deletion mutants of human nicotinamide mononucleotide adenylyltransferase isozyme 2: new insights on structure and function relationship.
20457531 2010 Unique expression pattern of human nicotinamide mononucleotide adenylyltransferase isozymes in red blood cells.
20388704 2010 Isoform-specific targeting and interaction domains in human nicotinamide mononucleotide adenylyltransferases.
20117162 2010 Axon degeneration: Mechanisms and implications of a distinct program from cell death.
19448972 2009 Nicotinamide/nicotinic acid mononucleotide adenylyltransferase, new insights into an ancient enzyme.
18344983 2008 NAD synthase NMNAT acts as a chaperone to protect against neurodegeneration.
17402747 2007 Initial-rate kinetics of human NMN-adenylyltransferases: substrate and metal ion specificity, inhibition by products and multisubstrate analogues, and isozyme contributions to NAD+ biosynthesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16118205 2005 Subcellular compartmentation and differential catalytic properties of the three human nicotinamide mononucleotide adenylyltransferase isoforms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14704851 2004 Enzymology of NAD+ homeostasis in man.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12574164 2003 Structural characterization of a human cytosolic NMN/NaMN adenylyltransferase and implication in human NAD biosynthesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788603 2002 Structure of human nicotinamide/nicotinic acid mononucleotide adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.