Property Summary

NCBI Gene PubMed Count 58
PubMed Score 77.33
PubTator Score 85.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.860 6.9e-05
subependymal giant cell astrocytoma 1.600 3.6e-02

Protein-protein Interaction (1)

Gene RIF (30)

AA Sequence

MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMA      1 - 70
ELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKS     71 - 140
LEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNI    141 - 210
HVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT     211 - 279
//

Text Mined References (63)

PMID Year Title