Property Summary

NCBI Gene PubMed Count 39
PubMed Score 10.51
PubTator Score 19.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.628 1.5e-02
esophageal adenocarcinoma 1.300 3.4e-02
psoriasis 2.200 3.2e-05
cutaneous lupus erythematosus 2.000 2.3e-05
astrocytoma 1.100 3.1e-08
glioblastoma 2.300 3.9e-04
posterior fossa group A ependymoma 2.100 2.4e-11
medulloblastoma, large-cell -1.200 5.8e-03
juvenile dermatomyositis 2.712 1.1e-16
intraductal papillary-mucinous carcinoma... 1.100 3.1e-02
lung cancer -2.700 9.2e-06
active Crohn's disease 1.274 3.6e-03
pancreatic cancer 1.100 1.4e-05
Multiple Sclerosis 1.200 3.1e-03
pediatric high grade glioma 2.400 6.7e-08
pilocytic astrocytoma 2.200 2.0e-09
primary Sjogren syndrome 1.200 2.1e-02
subependymal giant cell astrocytoma 2.210 3.3e-02
lung carcinoma -2.000 8.9e-22
ovarian cancer 2.500 1.4e-05
dermatomyositis 2.300 4.7e-03

Synonym

Accession Q13287 B5BU69 Q53TI8 Q9BVE5 Nmi
Symbols

Gene

NMI

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (21)

PMID Text
26342464 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response
26146406 N-myc and STAT interactor sensitizes breast cancer cells to cisplatin treatment through DRAM1 dependent autophagy.
25907116 The results showed that SARS coronavirus protein 6 can promote the ubiquitin-dependent proteosomal degradation of Nmi.
25669971 overexpression or depletion of NMI revealed its regulation on G1/S progression and cell proliferation (both in vitro and in vivo), and this effect was partially dependent on STAT1, which interacted with and was regulated by NMI.
25387807 Its potential function in transcriptional activation of NMI.
25174825 Results show that aberrant miR-29 expression may account for reduced NMI expression in breast tumors and mesenchymal phenotype of cancer cells that promotes invasive growth.
24936061 identified NMI induction as a novel negative feedback mechanism that decreases IRE1alpha-dependent activation of JNK and apoptosis in cytokine-exposed beta cells
23034180 Thus our work reveals a novel NMI-mediated, transcription-independent ARF induction pathway in response to cellular stresses.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19358268 Data suggest that overexpression of Nmi inhibits the Wnt/beta-catenin signaling via up-regulation of Dkk1 and retards tumor growth.
19240718 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18794094 Observational study of gene-disease association. (HuGE Navigator)
18051367 HIV-1 Tat downregulates N-myc (and STAT) interactor in HEK 293T cells
17565738 Activation of PKCdelta in response to Camptothecin treatment requires Myc and is important in CPT-mediated apoptosis signaling.
17197158 The results provide a novel role of CKIP-1 in cytokine signaling response and the biochemical mechanism, by which two previously identified modulators IFP35 and Nmi are involved via interactions.
16214168 identified an association of Sox10 with the N-myc interactor Nmi, which was mediated by the high-mobility group of Sox10 and the central region of Nmi; Nmi modulated the transcriptional activity of Sox10
15996661 STAT1 and Nmi are downstream targets of Ets-1 in MCF-7 human breast cancer cells
12019454 Apoptin mutant T1 still interacted with Nmi, suggesting that its C-terminal 11 AA was not essential for the interaction.
11916966 complex with BRCA1 and c-Myc inhibits c-Myc-induced human telomerase reverse transcriptase gene promoter activity in breast cancer
11911807 Dissociation of the IFN-induced protein NMI from IFP35 is a newly defined specific cytoplasmic event occurring during apoptosis.

AA Sequence

MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMK      1 - 70
FLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPV     71 - 140
PLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEI    141 - 210
GVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHF    211 - 280
QRAKNGGGEVDVVKCSLGQPHIAYFEE                                               281 - 307
//

Text Mined References (42)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26342464 2015 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response.
26146406 2015 N-Myc and STAT Interactor regulates autophagy and chemosensitivity in breast cancer cells.
25907116 2015 Severe acute respiratory syndrome coronavirus protein 6 mediates ubiquitin-dependent proteosomal degradation of N-Myc (and STAT) interactor.
25669971 2015 High expression of N-myc (and STAT) interactor predicts poor prognosis and promotes tumor growth in human glioblastoma.
25416956 2014 A proteome-scale map of the human interactome network.
25387807 2015 Genetic variants in N-myc (and STAT) interactor and susceptibility to glioma in a Chinese Han population.
25174825 2014 microRNA-29 negatively regulates EMT regulator N-myc interactor in breast cancer.
24936061 2014 A combined "omics" approach identifies N-Myc interactor as a novel cytokine-induced regulator of IRE1 protein and c-Jun N-terminal kinase in pancreatic beta cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034180 2012 NMI mediates transcription-independent ARF regulation in response to cellular stresses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19358268 2009 Nmi (N-Myc interactor) inhibits Wnt/beta-catenin signaling and retards tumor growth.
19240718 2009 Tagging single-nucleotide polymorphisms in candidate oncogenes and susceptibility to ovarian cancer.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18794094 2008 The effects of common genetic variants in oncogenes on ovarian cancer survival.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17565738 2007 Camptothecin-induced apoptosis is enhanced by Myc and involves PKCdelta signaling.
17406968 2007 Stability of Nmi protein is controlled by its association with Tip60.
17197158 2007 The PH domain containing protein CKIP-1 binds to IFP35 and Nmi and is involved in cytokine signaling.
16919237 2006 Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16214168 2005 The high-mobility group transcription factor Sox10 interacts with the N-myc-interacting protein Nmi.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15996661 2005 STAT1 and Nmi are downstream targets of Ets-1 transcription factor in MCF-7 human breast cancer cell.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11916966 2002 A novel tricomplex of BRCA1, Nmi, and c-Myc inhibits c-Myc-induced human telomerase reverse transcriptase gene (hTERT) promoter activity in breast cancer.
11911807 2002 Intracellular redistribution of interferon-inducible proteins Nmi and IFP 35 in apoptotic cells.
10950963 2000 Interferon-inducible Myc/STAT-interacting protein Nmi associates with IFP 35 into a high molecular mass complex and inhibits proteasome-mediated degradation of IFP 35.
10779520 2000 Interferon-alpha induces nmi-IFP35 heterodimeric complex formation that is affected by the phosphorylation of IFP35.
10597290 1999 Nmi protein interacts with regions that differ between MycN and Myc and is localized in the cytoplasm of neuroblastoma cells in contrast to nuclear MycN.
10574616 1999 Subcellular localization of interferon-inducible Myc/stat-interacting protein Nmi is regulated by a novel IFP 35 homologous domain.
9989503 1999 Functional association of Nmi with Stat5 and Stat1 in IL-2- and IFNgamma-mediated signaling.
9781816 1998 Interferon-induced upregulation and cytoplasmic localization of Myc-interacting protein Nmi.
8668343 1996 Isolation and characterization of Nmi, a novel partner of Myc proteins.