Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.17
PubTator Score 10.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 2.600 1.3e-03
osteosarcoma -5.196 2.2e-09
tuberculosis 2.300 1.2e-06

Gene RIF (12)

AA Sequence

MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEAD      1 - 70
NIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVDSDS     71 - 140
EVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDF    141 - 210
EEFVSFMTSGLSYILVVSQGSKHNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLER    211 - 280
QHLAQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQ    281 - 350
VVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQ    351 - 420
FAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTP    421 - 490
EQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISK    491 - 560
LKNIVHGASNAYEAKEVVNRLFEDPEEN                                              561 - 588
//

Text Mined References (21)

PMID Year Title